Products for Research Use Only
RegisterLogin

UBE2S, Human (GST)

CAT: 0804-HY-P71408Size: 1 EachDry Ice: YesHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P71408Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
The UBE2S protein is critical in cellular ubiquitination, accepting ubiquitin from the E1 complex and catalyzing covalent attachment to various proteins.UBE2S is a key contributor to cell cycle regulation, catalyzing "Lys-11"-linked polyubiquitination, which is critical for anaphase-promoting complex/cyclosome (APC/C) function.UBE2S Protein, Human (GST) is the recombinant human-derived UBE2S protein, expressed by E.coli , with N-GST labeled tag.
Product Name Alternative
UBE2S Protein, Human (GST), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ube2s-protein-human-gst.html
Smiles
MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL
Molecular Formula
27338 (Gene_ID) Q16763 (M1-L222) (Accession)
Molecular Weight
Approximately 50 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P71403-01UBE2I, Human (GST)
HY-P71402-01UBE2H, Human (GST)
HY-P71405-01UBE2K, Human (GST)
HY-P703042UBE2U, Human (sf9, GST)
HY-P71397-01UBE2A, Human (GST-His)
HY-RS15361UBE2S Human Pre-designed siRNA Set A
HY-P88195UBE2S Antibody (YA7879, Mouse)
HY-RS24472Ube2s Rat Pre-designed siRNA Set A
HY-RS18000Ube2s Mouse Pre-designed siRNA Set A
HY-P71401-01UBE2G2, Human (GST)

Alternative Products

CatalogName
C289-01Recombinant Human UBE2S (N-GST)
TMPJ-01138-01UBE2S Protein, Human, Recombinant (GST)
P519110UBE2S Protein (N-GST, Human)
PR02045Recombinant Human UBE2S Protein, N-GST
PKSH033189-01Recombinant Human UBE2S Protein (GST Tag)
MBS8433691-01Human UBE2S Recombinant Protein N-GST Tag
IHUUBE2SRNGST50UGHuman UBE2S Recombinant Protein N-GST Tag 50UG
32-9241-500Recombinant Human Ubiquitin-Conjugating Enzyme E2 S/UBE2S (N-GST)
MBS2553354-01Recombinant Human Ubiquitin-Conjugating Enzyme E2 S/UBE2S Protein (N-GST)
375752-01UBE2S, Recombinant, Human, aa1-222, GST-Tag (Ubiquitin-conjugating Enzyme E2 S)

Popular Products