Recombinant Human Fms-related tyrosine kinase 3 ligand (FLT3LG) , partial (Active)

• CAS Number:

  9000-83-3

• Gene Name:

  FLT-3L

• UniProt:

  P49771

• Expression Region:

  27-184aa

• Organism:

  Homo sapiens

• Target Sequence:

  TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQP

• Tag:

  Tag free

• Source:

  Mammalian cell

• Field of Research:

  Others

• Assay Type:

  Active Protein & In Stock Protein

• Endotoxin:

  ≤10 EU/mg by the LAL method

• Purity:

  Greater than 95% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  The ED50 as determined by the dose-dependent stimulation of the proliferation of human OCI-AML5 cells is ≤ 1.0 ng/ml, corresponding to a specific activity of ≥ 1 x 10^6 units/mg.

• Length:

  Partial

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm filtered solution containing PBS, 5% mannitoland 0.01% Tween 80, pH 7.4

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  17.8 kDa

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.