Products for Research Use Only
RegisterLogin

PLBD2, Rat (His-SUMO)

CAT: 0804-HY-P71557Size: 1 EachDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P71557Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
The PLBD2 protein is a putative phospholipase that may participate in cellular processes by interacting with IGF2R. Although the function and mechanism of the enzyme are unclear, its association with IGF2R suggests involvement in the insulin-like growth factor 2 receptor-related signaling pathway. PLBD2 Protein, Rat (His-SUMO) is the recombinant rat-derived PLBD2 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
Product Name Alternative
PLBD2 Protein, Rat (His-SUMO), Rat, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/plbd2-protein-rat-his-sumo.html
Smiles
GALPTLGPGWRRQNPEPPASRTRSLLLDAASGQLRLEYGFHPDAVAWANLTNAIRETGWAYLDLGTNGSYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKSFLEANLEWMQREMELSPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFNIKPLGFLLLQISGDLEDLEPALNKTNTKPSVGSGSCSALIKLLPGSHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLIAGNNLIFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQGCVLEWIRNIVANRLALDGATWADVFRRFNSGTYNNQWMIVDYKAFIPNGPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFESVFNASGLQALVAQYGDWFSYTRNPRAKIFQRDQSLVEDVDTMVRLMRYNDFLHDPLSLCEACSPKPNAENAISARSDLNPANGSYPFQALRQRAHGGIDVKVTSVALAKYMSMLAASGPTWDQLPPFQWSKSPFHNMLHMGQPDLWMFSPVKVPWD
Molecular Formula
246120 (Gene_ID) Q4QQW8 (G36-D585) (Accession)
Molecular Weight
Approximately 77.9 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P71553PLBD2, Mouse (His)
HY-P77148-01PLBD2, Human (HEK293, His)
HY-P71571GFER, Rat (His-SUMO)
HY-P71561CD300LF, Rat (Myc, His-SUMO)
HY-RS24307Plbd2 Rat Pre-designed siRNA Set A
HY-P704529CDK5, Human (His-SUMO)
HY-P72080-01APOBEC3A, Human (His-SUMO)
HY-P700595PRPS1, Human (His-SUMO)
HY-P70700-01TMEM173, Human (Sumo-His)
HY-P72116-01CAPZA2, Human (His-SUMO)

Alternative Products

CatalogName
TMPH-03361-01PLBL2/PLBD2 Protein, Rat, Recombinant (His & SUMO)
QP7660-ec-1mgRecombinant Rat PLBD2 Protein, His-SUMO, E.coli-1mg
QP7660-ec-200ugRecombinant Rat PLBD2 Protein, His-SUMO, E.coli-200ug
QP7660-ec-100ugRecombinant Rat PLBD2 Protein, His-SUMO, E.coli-100ug
QP7660-ec-10ugRecombinant Rat PLBD2 Protein, His-SUMO, E.coli-10ug
QP7660-ec-50ugRecombinant Rat PLBD2 Protein, His-SUMO, E.coli-50ug
QP7660-ec-500ugRecombinant Rat PLBD2 Protein, His-SUMO, E.coli-500ug
E40KMPH4456Human PLBD2 Protein, His Tag
P527658PLBD2 Protein (C-His, Human)
370747-01Plbd2, Recombinant, Rat, aa36-585, His-SUMO-Tag (Putative Phospholipase B-like 2)

Popular Products