Recombinant Mouse Uncharacterized protein C1orf54 homolog | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS7018116-02	Recombinant Mouse Uncharacterized protein KIAA1467 (Kiaa1467)
MBS7035748-02	Recombinant Mouse Uncharacterized protein ZMYM6NB (Zmym6nb)
MBS7038693-02	Recombinant Mouse Uncharacterized protein C12orf59 homolog
MBS7038694-02	Recombinant Mouse Uncharacterized protein C12orf69 homolog
MBS7038697-02	Recombinant Mouse Uncharacterized protein C17orf62 homolog
MBS7038700-02	Recombinant Mouse Uncharacterized protein C1orf185 homolog
MBS7038701-02	Recombinant Mouse Uncharacterized protein C1orf43 homolog
MBS7038703-02	Recombinant Mouse Uncharacterized protein C2orf82 homolog
MBS7038704-02	Recombinant Mouse Uncharacterized protein C3orf18 homolog
MBS7038706-02	Recombinant Mouse Uncharacterized protein C3orf43 homolog

Recombinant Mouse Uncharacterized protein C1orf54 homolog

CAT:

399-CSB-MP848110MOd7-01

Size:

1 mg

Price:

Ask

For price, please contact [email protected].

Recombinant Mouse Uncharacterized protein C1orf54 homolog

UniProt: Q8R2K8
Expression Region: 17-148aa
Organism: Mus musculus
Target Sequence: QEYDHEEQLEEGDYYQVAYYYYTVTPNYDDFSVNFTVDYSVFESEDRLNRLNKEVTTTEAVETTASSYSLHTELMDPQNPVTTKPVTTEPVTTEPVTTEPQSPNQNDAMSTLQSPVSCFLLWTLLQGGVHFM
Tag: C-terminal 10xHis-tagged
Source: Mammalian cell
Field of Research: Others
Assay Type: Developed Protein
Purity: Greater than 85% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 17.0 kDa
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Protein Length: Full Length

Complementary Product Range

Our range of products, including Recombinant Mouse Uncharacterized protein C1orf54 homolog, falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
CSB-MP848110MO-02	Recombinant Mouse Uncharacterized protein C1orf54 homolog
CSB-MP848110MOd7-02	Recombinant Mouse Uncharacterized protein C1orf54 homolog
CSB-MP848110MO-01	Recombinant Mouse Uncharacterized protein C1orf54 homolog
CSB-MP848110MOd7-01	Recombinant Mouse Uncharacterized protein C1orf54 homolog
CSB-MP848110MO-03	Recombinant Mouse Uncharacterized protein C1orf54 homolog
CSB-MP848110MOd7-03	Recombinant Mouse Uncharacterized protein C1orf54 homolog
CSB-EP2043DO-02	Recombinant Dog Uncharacterized protein (DMP1)
CSB-EP5481DXUa2-02	Recombinant Cricetulus griseus Uncharacterized protein
CSB-EP360306EGX-02	Recombinant Uncharacterized deoxyribonuclease YcfH (ycfH)
CSB-RP187544Ba-03	Recombinant Corynebacterium efficiens Uncharacterized protein

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on