Recombinant Human Inositol 1, 4, 5-trisphosphate receptor-interacting protein-like 1 (ITPRIPL1) , partial (Active)
CAT:
399-CSB-MP756966HU-03
Size:
20 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No








Recombinant Human Inositol 1, 4, 5-trisphosphate receptor-interacting protein-like 1 (ITPRIPL1) , partial (Active)
- CAS Number: 9000-83-3
- Gene Name: ITPRIPL1
- UniProt: Q6GPH6
- Expression Region: 25-103aa
- Organism: Homo sapiens
- Target Sequence: HPLMVSDRMDLDTLARSRQLEKRMSEEMRLLEMEFEERKRAAEQRQKAENFWTGDTSSDQLVLGKKDMGWPFQADGQEG
- Tag: C-terminal 10xHis-tagged
- Source: Mammalian cell
- Field of Research: Others
- Assay Type: Active Protein & In Stock Protein
- Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
- Purity: Greater than 95% as determined by SDS-PAGE.
- Activity: Yes
- Bioactivity: Measured by its binding ability in a functional ELISA. Immobilized Human ITPRIPL1 at 2 μg/mL can bind Anti-ITPRIPL1 recombinant antibody (CSB-RA756966MA1HU). The EC50 is 6.537-7.663 ng/mL.
- Length: Partial
- Form: Lyophilized powder
- Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 10.7 kDa
- References & Citations: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Wilson R.K. Nature 434:724-731 (2005)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Protein Length: Partial