Recombinant Human Lymphotoxin-alpha (LTA) (Active)

Recombinant Human Lymphotoxin-alpha (LTA) (Active)

• CAS Number: 9000-83-3
• Gene Name: LTA
• UniProt: P01374
• Expression Region: 35-205aa
• Organism: Homo sapiens
• Target Sequence: LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
• Tag: N-terminal 6xHis-tagged
• Source: Mammalian cell
• Field of Research: Cytokine
• Assay Type: Active Protein & In Stock Protein
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Purity: Greater than 95% as determined by SDS-PAGE.
• Activity: Yes
• Bioactivity: ①Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 μg/ml can bind human TNFRSF1B (CSB-MP023978HU2), the EC50 is 1.632-2.699 ng/ml.②Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 μg/ml can bind human TNFR1 (CSB-MP023977HU1) , the EC50 of human LTA protein is 4.409-6.797 ng/ml.
• Length: Full Length of Mature Protein
• Form: Lyophilized powder
• Buffer: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Molecular Weight: 20.8 kDa
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Protein Length: Full Length of Mature Protein