Recombinant Human Histone H4 (H4C1)

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
P6084-03	Recombinant Human Histone H2A
P5546-03	Recombinant Human Histone H3.1
P4559-02	Recombinant Human Histone H1
P2657-02	Recombinant Human Histone H1.0
P2185-02	Recombinant Human Histone H3.2
B2010564	Histone H2A.Z (Human Recombinant)
P6084-01	Recombinant Human Histone H2A
P5546-01	Recombinant Human Histone H3.1
P0070	Recombinant Human Histone-H3
MBS9420302-02	Recombinant Human Histone H2A.J

CAT:

399-CSB-EP010429HU-03

Size:

20 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Human Histone H4 (H4C1)

Gene Name: H4C1
UniProt: P62805
Expression Region: 2-103aa
Organism: Homo sapiens
Target Sequence: SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Tag: C-terminal 6xHis-tagged
Source: E.coli
Field of Research: Others
Assay Type: In Stock Protein
Relevance: Seed storage protein.
Purity: Greater than 85% as determined by SDS-PAGE.
Activity: Not Test
Length: Full Length of Mature Protein
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 18.1 kDa
References & Citations: "Endosperm-specific expression of human acid beta-glucosidase in a waxy rice." Patti T., Bembi B., Cristin P., Mazzarol F., Secco E., Pappalardo C., Musetti R., Martinuzzi M., Versolatto S., Cariati R., Dardis A., Marchetti S. Rice (N Y) 5:34-34 (2012)
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Human Histone H4 (H4C1), falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on

Cat	Name
CSB-EP010379HUd8-02	Recombinant Human Histone H1.3 (HIST1H1D)
CSB-EP747894HU-01	Recombinant Human Histone H2A.V (H2AFV)
CSB-EP010418HU-03	Recombinant Human Histone H3.1 (HIST1H3A)
CSB-EP010100HU-01	Recombinant Human Histone H2A.Z (H2AFZ)
CSB-EP010100HU-03	Recombinant Human Histone H2A.Z (H2AFZ)
CSB-EP010097HUe0-03	Recombinant Human Histone H2A.x (H2AFX)
CSB-EP010094HU-02	Recombinant Human Histone H2A.J (H2AFJ)
CSB-EP010094HU-01	Recombinant Human Histone H2A.J (H2AFJ)
CSB-EP010094HU-03	Recombinant Human Histone H2A.J (H2AFJ)
CSB-EP010429HU-03	Recombinant Human Histone H4 (H4C1)