Recombinant Human Follistatin-related protein 1 (FSTL1) , partial
CAT:
399-CSB-EP613266HU1-03
Size:
20 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




Recombinant Human Follistatin-related protein 1 (FSTL1) , partial
- CAS Number: 9000-83-3
- Gene Name: FSTL1
- UniProt: Q12841
- Expression Region: 176-285aa
- Organism: Homo sapiens
- Target Sequence: ETAINITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTR
- Tag: N-terminal 6xHis-GST-tagged
- Source: E.coli
- Field of Research: Cardiovascular
- Assay Type: Developed Protein
- Relevance: Secreted glycoprotein that is involved in various physiological processes, such as angiogenesis, regulation of the immune response, cell proliferation and differentiation. Plays a role in the development of the central nervous system, skeletal system, lungs, and ureter. Promotes endothelial cell survival, migration and differentiation into network structures in an AKT-dependent manner. Also promotes survival of cardiac myocytes. Initiates various signaling cascades by activating different receptors on the cell surface such as DIP2A, TLR4 or BMP receptors.
- Purity: Greater than 90% as determined by SDS-PAGE.
- Activity: Not Test
- Length: Partial
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 43.8 kDa
- References & Citations: "Fstl1 Promotes Glioma Growth Through the BMP4/Smad1/5/8 Signaling Pathway." Jin X., Nie E., Zhou X., Zeng A., Yu T., Zhi T., Jiang K., Wang Y., Zhang J., You Y. Cell. Physiol. Biochem. 44:1616-1628 (2017)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.