Recombinant Rat Purine nucleoside phosphorylase (Pnp)
CAT:
399-CSB-BP311126RA-02
Size:
100 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No




Recombinant Rat Purine nucleoside phosphorylase (Pnp)
- CAS Number: 9000-83-3
- Gene Name: Pnp
- UniProt: P85973
- Expression Region: 1-289aa
- Organism: Rattus norvegicus
- Target Sequence: MENEFTYEDYQRTAEWLRSHTKHRPQVAVICGSGLGGLTAKLTQPQAFDYNEIPNFPQSTVQGHAGRLVFGFLNGRSCVMMQGRFHMYEGYSLSKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFCGQNPLRGPNDERFGVRFPAMSDAYDRDMRQKAFNAWKQMGEQRELQEGTYIMSAGPTFETVAESCLLRMLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVVMDYNNLEKASHQEVLEAGKAAAQKLEQFVSILMESIPPRERAN
- Tag: C-terminal 6xHis-tagged
- Source: Baculovirus
- Field of Research: Others
- Assay Type: In Stock Protein
- Relevance: Catalyzes the phosphorolytic breakdown of the N-glycosidic bond in the beta- (deoxy)ribonucleoside molecules, with the formation of the corresponding free purine bases and pentose-1-phosphate. Preferentially acts on 6-oxopurine nucleosides including inosine and guanosine.
- Purity: Greater than 90% as determined by SDS-PAGE.
- Activity: Not Test
- Length: Full Length
- Form: Liquid or Lyophilized powder
- Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 33.1 kDa
- References & Citations: "Purine nucleoside phosphorylase inhibition ameliorates age-associated lower urinary tract dysfunctions." Birder L.A., Wolf-Johnston A., Wein A.J., Cheng F., Grove-Sullivan M., Kanai A.J., Watson A.M., Stoltz D., Watkins S.C., Robertson A.M., Newman D., Dmochowski R.R., Jackson E.K. JCI Insight 5:140109-140109 (2020)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.