Recombinant Avian infectious bronchitis virus Nucleoprotein (N)

Recombinant Avian infectious bronchitis virus Nucleoprotein (N)

• CAS Number: 9000-83-3
• Gene Name: N
• UniProt: Q96598
• Expression Region: 1-409aa
• Organism: Avian infectious bronchitis virus (strain Vic S) (IBV)
• Target Sequence: MASGKAAGKSDAPTPIIKLGGPKPPKIGSSGNASWFQAIKAKKLNVPQPKFEGSGVPDNNNIKPSQQHGYWRRQARYKPGKSGRKPVPDAWYFYYTGTGPAADLNWGENQDGIVWVAAKGADTKSRSNQGTRDPDKFDQYPLRFSDGGPDGNFRWDFIPLNRGRSGRSTAASSAASSRAPSREGSRGRRSGAEDDLIARAAKIIQDQQKRGSRITKAKADEMAHRRYCKRTIPPGYRVDQVFGPRTKGKEGNFGDDKMNEEGIKDGRVTATLNLIPSSHACLFGSRVTPKLQPDGLHLKFEFTTVVPRDDPQFDNYVKICDQCVDGVGTRPKDDEPRPKSRSSSRPATRGNSPAPRQQRPKKEKKPKKQDDEVDKALTSDEERNNAQLEFDDEPKVINWGDSALGENEL
• Tag: C-terminal 6xHis-tagged
• Source: E.coli
• Field of Research: Microbiology
• Assay Type: In Stock Protein
• Relevance: Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication.
• Purity: Greater than 85% as determined by SDS-PAGE.
• Activity: Not Test
• Length: Full Length
• Form: Liquid or Lyophilized powder
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Molecular Weight: 46.1 kDa
• References & Citations: "Novel variation in the N protein of avian infectious bronchitis virus." Sapats S.I., Ashton F., Wright P.J., Ignjatovic J. Virology 226:412-417 (1996)
• Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.