Products for Research Use Only
RegisterLogin

PMM2, Human (His)

CAT: 0804-HY-P71021Size: 1 EachDry Ice: YesHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P71021Size:1 Each
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
The PMM2 protein is essential for the synthesis of GDP-mannose and polyethylene glycol-phosphate-mannose, which are essential for the mannosyl transfer reaction. Its enzymatic activity is integral to the biosynthesis of mannose-containing glycoconjugates, affects protein glycosylation and contributes to cellular homeostasis. PMM2 Protein, Human (His) is the recombinant human-derived PMM2 protein, expressed by E. coli , with C-6*His labeled tag.
Product Name Alternative
PMM2 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pmm2-protein-human-his.html
Smiles
MAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS
Molecular Formula
5373 (Gene_ID) O15305-1 (M1-S246) (Accession)
Molecular Weight
Approximately 29 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-RS10767PMM2 Human Pre-designed siRNA Set A
HY-P71216PMM1, Human (His)
HY-RS25860Pmm2 Rat Pre-designed siRNA Set A
HY-RS19368Pmm2 Mouse Pre-designed siRNA Set A
HY-P70573A-01IRF5, Human (His)
HY-P705610METTL14, Human (His)
HY-P705479-01SFTPA1, Human (His)
HY-P705446RAF1, Human (His)
HY-P705436TIA1, Human (His)
HY-P705431METTL7B, Human (His)

Alternative Products

CatalogName
E40KMPH5101Human PMM2 Protein, His Tag
P517595PMM2 Protein (C-His, Human)
TMPY-03611-01PMM2 Protein, Human, Recombinant (His)
P527674PMM2 Protein (N-His, Human)
KMH1573-01Recombinant Human PMM2 Protein, His Tag
GTR19117326-01Recombinant Human PMM2 Protein, N-His
MBS8121757-01PMM2 Protein, Human, Recombinant (His Tag)
PKSH032894-01Recombinant Human PMM2 Protein (His Tag)
PR02026Recombinant Human PMM2 Protein, C-His
AR09665PU-NPMM2 (1-246, His-tag) Human Protein

Popular Products