Recombinant Human C-type lectin domain family 4 member C (CLEC4C) , partial (Active)
CAT:
399-CSB-MP855470HUh7-03
Size:
20 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No








Recombinant Human C-type lectin domain family 4 member C (CLEC4C) , partial (Active)
- CAS Number: 9000-83-3
- Gene Name: CLEC4C
- UniProt: Q8WTT0
- Expression Region: 45-213aa
- Organism: Homo sapiens
- Target Sequence: NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
- Tag: N-terminal 6xHis-Myc-tagged
- Source: Mammalian cell
- Field of Research: Immunology
- Assay Type: Active Protein & In Stock Protein
- Relevance: May play a role in antigen capturing by dendritic cells.
- Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
- Purity: Greater than 95% as determined by SDS-PAGE.
- Activity: Yes
- Bioactivity: Measured by its binding ability in a functional ELISA. Immobilized Human CLEC4C at 2 μg/mL can bind Anti-CLEC4C recombinant antibody (CSB-RA855470MA1HU),the EC50 is 7.658-12.99 ng/mL.
- Length: Partial
- Form: Lyophilized powder
- Buffer: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
- Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
- Molecular Weight: 24.1 kDa
- References & Citations: "Molecular and genomic characterization of human DLEC, a novel member of the C-type lectin receptor gene family preferentially expressed on monocyte-derived dendritic cells." Arce I., Roda-Navarro P., Montoya M.C., Hernanz-Falcon P., Puig-Kroger A., Fernandez-Ruiz E. Eur. J. Immunol. 31:2733-2740 (2001)
- Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Protein Length: Partial