GDF9 Antibody

CAT:
800-V8671-20UG
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
GDF9 Antibody - image 1

GDF9 Antibody

  • Description :

    GDF9 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Growth factors synthesized by ovarian somatic cells directly affect oocyte growth and function. GDF9 is expressed in oocytes and is thought to be required for ovarian folliculogenesis. GDF9/4261 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity.
  • Specifications :

    ELISA: order Ab without BSA for coating, Western blot: 1-2 µg/mL, Immunohistochemistry (FFPE) : 1-2 µg/mL for 30 minutes at RT
  • UniProt :

    O60383
  • Host :

    Mouse
  • Reactivity :

    Human
  • Immunogen :

    Amino acids VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC from the C-terminal region of human GDF9 were used as the immunogen for the GDF9 antibody. The epitope has been mapped to amino acids EPDG.
  • Clonality :

    Monoclonal
  • Isotype :

    IgG1
  • Clone :

    GDF9/4261
  • Applications :

    ELISA, WB, IHC-P
  • Purity :

    Protein G affinity chromatography
  • Format :

    Purified
  • Buffer :

    0.2 mg/ml in 1X PBS with 0.1 mg/ml BSA (US sourced), 0.05% sodium azide
  • Reconstitution :

    Store the GDF9 antibody at 2-8oC (with azide) or aliquot and store at -20oC or colder (without azide).
  • Limitations :

    This GDF9 antibody is available for research use only.
  • Storage Conditions :

    Store the GDF9 antibody at 2-8°C (with azide) or aliquot and store at -20°C or colder (without azide) .
  • Formulation :

    0.2 mg/mL in 1X PBS with 0.1 mg/mL BSA (US sourced) and 0.05% sodium azide
  • Applications Notes :

    Optimal dilution of the GDF9 antibody should be determined by the researcher.
  • CAS Number :

    9007-83-4
  • Location :

    Cytoplasmic (secreted)
  • Image Legend :

    IHC staining of FFPE human ovary with GDF9 antibody. HIER: boil tissue sections in pH 9 10mM Tris with 1mM EDTA for 20 min and allow to cool before testing.