AFF4 Antibody
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


AFF4 Antibody
Description :
The AFF4 gene encodes a scaffold protein that functions as a core component of the super elongation complex (SEC), which is involved in transcriptional regulation during embryogenesis. The protein encoded by this gene belongs to the AF4 family of transcription factors involved in leukemia. It is a component of the positive transcription elongation factor b (P-TEFb) complex. This gene is mapped to chromosome 5q31.Specifications :
Western blot: 1-2 µg/mL, Flow cytometry: 1-3ug/million cellsUniProt :
Q9UHB7Host :
MouseReactivity :
HumanImmunogen :
Amino acids RNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQ from the human protein were used as the immunogen for the AFF4 antibody.Clonality :
MonoclonalIsotype :
IgG2bClone :
8G12Applications :
WB, FACSPurity :
Affinity purifiedFormat :
Antigen affinity purifiedBuffer :
Lyophilized from 1X PBS with 2% TrehaloseReconstitution :
After reconstitution, the AFF4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.Limitations :
This AFF4 antibody is available for research use only.Storage Conditions :
After reconstitution, the AFF4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.Formulation :
0.5 mg/mL if reconstituted with 0.2ml sterile DI waterApplications Notes :
Optimal dilution of the AFF4 antibody should be determined by the researcher.CAS Number :
9007-83-4Image Legend :
Western blot testing of human 1) HeLa, 2) HepG2, 3) Caco-2, 4) HEK293, 5) MDA-MB-453, 6) PANC-1 and 7) SW620 cell lysate with AFF4 antibody. Predicted molecular weight ~127/98/39 kDa (isoforms 1/2/3) .

