MBD1 Antibody
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


MBD1 Antibody
Description:
MBD1 (Methyl-CpG-Binding Domain Protein 1), also known as PCM1 or CXXC3, is a protein that in humans is encoded by the MBD1 gene. Using PCR on a hybrid panel and FISH, Hendrich et al. (1999) mapped the MBD1 gene to chromosome 18q21, 2.1 cM distal to MBD2. Using yeast 2-hybrid analysis, reciprocal immunoprecipitation analysis, and protein pull-down assays, Fujita et al. (2003) showed that MBD1 interacted directly with MCAF. Deletion analysis revealed that the C-terminal transcriptional repressor domain (TRD) of MBD1 interacted with a conserved C-terminal domain of MCAF. Reporter gene assays showed that MCAF increased the repressive function of the isolated TRD of MBD1 against SP1. Chromatin immunoprecipitation analysis revealed that MBD1 linked MCAF to methylated promoters. Uchimura et al. (2006) found that MBD1 was multiply sumoylated in HeLa cells. Sumoylation did not alter the intracellular localization of MBD1 at nuclear foci in C-33A human cervical cancer cells.Specifications:
Western blot: 0.5-1 µg/mL, Flow cytometry: 1-3ug/million cellsUniProt:
Q9UIS9Host:
RabbitReactivity:
Human, Mouse, RatImmunogen:
Amino acids DLTLFDFKQGILCYPAPKAHPVAVASKKRK from the human protein were used as the immunogen for the MBD1 antibody.Clonality:
PolyclonalIsotype:
IgGApplications:
WB, FACSPurity:
Affinity purifiedFormat:
Antigen affinity purifiedBuffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azideReconstitution:
After reconstitution, the MBD1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.Limitations:
This MBD1 antibody is available for research use only.Storage Conditions:
After reconstitution, the MBD1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.Formulation:
0.5 mg/mL if reconstituted with 0.2ml sterile DI waterApplications Notes:
Optimal dilution of the MBD1 antibody should be determined by the researcher.CAS Number:
9007-83-4Image Legend:
Flow cytometry testing of human A549 cells with MBD1 antibody at 1ug/million cells (blocked with goat sera) ; Red=cells alone, Green=isotype control, Blue= MBD1 antibody.
