CD38 Antibody

• Description:

  The protein encoded by this gene is a non-lineage-restricted, type II transmembrane glycoprotein that synthesizes and hydrolyzes cyclic adenosine 5'-diphosphate-ribose, an intracellular calcium ion mobilizing messenger. The release of soluble protein and the ability of membrane-bound protein to become internalized indicate both extracellular and intracellular functions for the protein. This protein has an N-terminal cytoplasmic tail, a single membrane-spanning domain, and a C-terminal extracellular region with four N-glycosylation sites. Crystal structure analysis demonstrates that the functional molecule is a dimer, with the central portion containing the catalytic site. It is used as a prognostic marker for patients with chronic lymphocytic leukemia. Alternative splicing results in multiple transcript variants.

• Specifications:

  Western blot: 0.5-1 µg/mL, Immunohistochemistry: 1-2 µg/mL, Immunofluorescence: 2-4 µg/mL, Flow cytometry: 1-3ug/million cells

• UniProt:

  P28907

• Host:

  Rabbit

• Reactivity:

  Human

• Immunogen:

  Amino acids EVHNLQPEKVQTLEAWVIHGGREDSRDLCQD from the human protein were used as the immunogen for the CD38 antibody.

• Clonality:

  Polyclonal

• Isotype:

  IgG

• Applications:

  WB, IHC-P, IF, FACS

• Purity:

  Affinity purified

• Format:

  Antigen affinity purified

• Buffer:

  Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

• Reconstitution:

  After reconstitution, the CD38 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations:

  This CD38 antibody is available for research use only.

• Storage Conditions:

  After reconstitution, the CD38 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation:

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes:

  Optimal dilution of the CD38 antibody should be determined by the researcher.

• CAS Number:

  9007-83-4

• Image Legend:

  IHC staining of FFPE human tonsil with CD38 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.