NONO Antibody / p54nrb

NONO Antibody / p54nrb

• Description: Non-POU domain-containing octamer-binding protein is a protein that in humans is encoded by the NONO gene. This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16.
• UniProt: Q15233
• Host: Mouse
• Immunogen: Amino acids MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ were used as the immunogen for the NONO antibody.
• Clonality: Monoclonal
• Isotype: IgG1
• Applications: WB, ICC, FACS
• Format: Purified
• Buffer: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Reconstitution: After reconstitution, the NONO antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
• Limitations: This NONO antibody is available for research use only.