CCT3 Antibody

• Description :

  T-complex protein 1 subunit gamma is a protein that in humans is encoded by the CCT3 gene. The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC) . This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants have been characterized for this gene. In addition, a pseudogene of this gene has been found on chromosome 8.

• Specifications :

  Western blot: 0.5-1 µg/mL

• UniProt :

  P49368

• Host :

  Mouse

• Reactivity :

  Human

• Immunogen :

  Amino acids EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ were used as the immunogen for the CCT3 antibody.

• Clonality :

  Monoclonal

• Isotype :

  IgG1

• Clone :

  12H4

• Applications :

  WB

• Purity :

  Protein G affinity

• Format :

  Purified

• Buffer :

  Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

• Reconstitution :

  After reconstitution, the CCT3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations :

  This CCT3 antibody is available for research use only.

• Storage Conditions :

  After reconstitution, the CCT3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation :

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes :

  Optimal dilution of the CCT3 antibody should be determined by the researcher.

• CAS Number :

  9007-83-4

• Location :

  Cytoplasm

• Image Legend :

  Western blot testing of human 1) HeLa, 2) MCF7, 3) COLO-320, 4) HepG2 and 5) HT-1080 cell lysate with CCT3 antibody at 0.5ug/ml. Predicted molecular weight ~61 kDa.