CCT3 Antibody

CAT:
800-RQ4525
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
CCT3 Antibody - image 1

CCT3 Antibody

  • Description :

    T-complex protein 1 subunit gamma is a protein that in humans is encoded by the CCT3 gene. The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC) . This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants have been characterized for this gene. In addition, a pseudogene of this gene has been found on chromosome 8.
  • Specifications :

    Western blot: 0.5-1 µg/mL
  • UniProt :

    P49368
  • Host :

    Mouse
  • Reactivity :

    Human
  • Immunogen :

    Amino acids EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ were used as the immunogen for the CCT3 antibody.
  • Clonality :

    Monoclonal
  • Isotype :

    IgG1
  • Clone :

    12H4
  • Applications :

    WB
  • Purity :

    Protein G affinity
  • Format :

    Purified
  • Buffer :

    Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
  • Reconstitution :

    After reconstitution, the CCT3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Limitations :

    This CCT3 antibody is available for research use only.
  • Storage Conditions :

    After reconstitution, the CCT3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Formulation :

    0.5 mg/mL if reconstituted with 0.2ml sterile DI water
  • Applications Notes :

    Optimal dilution of the CCT3 antibody should be determined by the researcher.
  • CAS Number :

    9007-83-4
  • Location :

    Cytoplasm
  • Image Legend :

    Western blot testing of human 1) HeLa, 2) MCF7, 3) COLO-320, 4) HepG2 and 5) HT-1080 cell lysate with CCT3 antibody at 0.5ug/ml. Predicted molecular weight ~61 kDa.

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide