FRA1 Antibody / Fos-related antigen 1

• Description:

  Fos-related antigen 1 (FRA1) is a protein that in humans is encoded by the FOSL1 gene. The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. Several transcript variants encoding different isoforms have been found for this gene.

• UniProt:

  P15407

• Host:

  Rabbit

• Immunogen:

  Amino acids QPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPH from the human protein were used as the immunogen for the FRA1 antibody.

• Clonality:

  Polyclonal

• Isotype:

  IgG

• Applications:

  WB

• Format:

  Antigen affinity purified

• Buffer:

  0.5mg/ml if reconstituted with 0.2ml sterile DI water

• Reconstitution:

  After reconstitution, the FRA1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations:

  This FRA1 antibody is available for research use only.

• CAS Number:

  9007-83-4