FABP5 Antibody (epidermal)
CAT:
800-RQ4416
Size:
100 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
FABP5 Antibody (epidermal)
- Description: FABP5, Fatty acid-binding protein, epidermal, is a protein that in humans is encoded by the FABP5 gene. This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. It is mapped to 8q21.13. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism.
- CAS Number: 9007-83-4
- UniProt: Q01469
- Host: Rabbit
- Immunogen: Amino acids KWRLMESHGFEEYMKELGVGLALRKMAAMAKPD from the human protein were used as the immunogen for the FABP5 antibody.
- Clonality: Polyclonal
- Isotype: IgG
- Applications: WB, IF
- Format: Antigen affinity purified
- Buffer: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
- Reconstitution: After reconstitution, the FABP5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
- Limitations: This FABP5 antibody is available for research use only.