NPC2 Antibody / Niemann Pick C2

• Description:

  NPC2 is a protein associated with Niemann-Pick disease, type C. This gene is mapped to chromosome 14q24.3. It encodes a protein containing a lipid recognition domain. The encoded protein may function in regulating the transport of cholesterol through the late endosomal/lysosomal system. Mutations in this gene have been associated with Niemann-Pick disease, type C2 and frontal lobe atrophy.

• UniProt:

  P61916

• Host:

  Rabbit

• Immunogen:

  Amino acids KSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVS from the human protein were used as the immunogen for the NPC2 antibody.

• Clonality:

  Polyclonal

• Isotype:

  IgG

• Applications:

  WB, IHC-P

• Format:

  Antigen affinity purified

• Buffer:

  0.5mg/ml if reconstituted with 0.2ml sterile DI water

• Reconstitution:

  After reconstitution, the NPC2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations:

  This NPC2 antibody is available for research use only.

• CAS Number:

  9007-83-4