TrkA Antibody

• Description:

  Neurotrophic tyrosine kinase receptor type 1, also called Trk-A, is a protein that in humans is encoded by the NTRK1 gene. The NTKR1 gene encodes the neurotrophic tyrosine kinase-1 receptor and belongs to a family of nerve growth factor receptors whose ligands include neurotrophins. This gene is mapped to 1q23.1. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. The presence of this kinase leads to cell differentiation and may play a role in specifying sensory neuron subtypes. Mutations in this gene have been associated with congenital insensitivity to pain, anhidrosis, self-mutilating behavior, mental retardation and cancer.

• Specifications:

  Western blot: 0.5-1 µg/mL

• UniProt:

  P04629

• Host:

  Rabbit

• Reactivity:

  Human

• Immunogen:

  Amino acids EVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVL from the human protein were used as the immunogen for the TrkA antibody.

• Clonality:

  Polyclonal

• Isotype:

  IgG

• Applications:

  WB

• Purity:

  Antigen affinity purified

• Format:

  Antigen affinity purified

• Buffer:

  Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

• Reconstitution:

  After reconstitution, the TrkA antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations:

  This TrkA antibody is available for research use only.

• Storage Conditions:

  After reconstitution, the TrkA antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation:

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes:

  Optimal dilution of the TrkA antibody should be determined by the researcher.

• CAS Number:

  9007-83-4

• Image Legend:

  Western blot testing of human 1) HeLa, 2) SGC-7901 and 3) THP-1 cell lysate with TrkA antibdoy at 0.5ug/ml. Expected molecular weight: 85~140 kDa depending on glycosylation level.