CEP68 Antibody

• Description:

  Centrosomal protein of 68 kDa is a protein that in humans is encoded by the CEP68 gene. It is mapped to chromosome 2. CEP68 is required for centrosome cohesion. It decorates fibres emanating from the proximal ends of centrioles. CEP68 and Rootletin depend both on each other for centriole association, and both also require CEP250 for their function.

• Specifications:

  Western blot: 0.5-1 µg/mL

• UniProt:

  Q76N32

• Host:

  Rabbit

• Reactivity:

  Human, Mouse, Rat

• Immunogen:

  Amino acids ELICWLYNVADVTDHGTAARSNLTSLKSSLQLYRQFKKDID were used as the immunogen for the CEP68 antibody.

• Clonality:

  Polyclonal

• Isotype:

  IgG

• Applications:

  WB

• Purity:

  Antigen affinity purified

• Format:

  Antigen affinity purified

• Buffer:

  Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

• Reconstitution:

  After reconstitution, the CEP68 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations:

  This CEP68 antibody is available for research use only.

• Storage Conditions:

  After reconstitution, the CEP68 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation:

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes:

  Optimal dilution of the CEP68 antibody should be determined by the researcher.

• CAS Number:

  9007-83-4

• Location:

  Cytoplasm, cytoskeleton

• Image Legend:

  Western blot testing of human 1) HeLa, 2) COLO-320, 3) SK-O-V3, 4) Jurkat, 5) rat heart and 6) mouse heart lysate with CEP68 antibody at 0.5ug/ml. Predicted molecular weight ~81 kDa (isoform 1), ~67 kDa (isoform 2) .