GSK3 alpha Antibody / GSK3A

• Description:

  Glycogen synthase kinase-3 alpha is an enzyme that in humans is encoded by the GSK3A gene. This gene encodes a multifunctional Ser/Thr protein kinase that is implicated in the control of several regulatory proteins including glycogen synthase, and transcription factors, such as JUN. It also plays a role in the WNT and PI3K signaling pathways, as well as regulates the production of beta-amyloid peptides associated with Alzheimer's disease.

• Specifications:

  Western Blot: 0.5-1 µg/mL

• UniProt:

  P49840

• Host:

  Rabbit

• Reactivity:

  Mouse, Rat

• Immunogen:

  Amino acids QEVAYTDIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKR from the human protein were used as the immunogen for the GSK3 alpha antibody.

• Clonality:

  Polyclonal

• Isotype:

  IgG

• Applications:

  WB

• Purity:

  Antigen affinity purified

• Format:

  Antigen affinity purified

• Buffer:

  Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

• Reconstitution:

  After reconstitution, the GSK3 alpha antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations:

  This GSK3 alpha antibody is available for research use only.

• Storage Conditions:

  After reconstitution, the GSK3 alpha antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation:

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes:

  Optimal dilution of the GSK3 alpha antibody should be determined by the researcher.

• Prediction Reactivity:

  Human

• CAS Number:

  9007-83-4

• Image Legend:

  Western blot testing of 1) rat brain, 2) rat testis and 3) mouse testis lysate with GSK3 alpha antibody at 0.5ug/ml. Predicted molecular weight ~51 kDa.