ADAM2 Antibody

CAT:
800-R32785
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
ADAM2 Antibody - image 1

ADAM2 Antibody

  • Description :

    ADAM2 (A Disintegrin and Metalloproteinase Domain 2), also known as FTNB or PH30, is an enzyme that in humans is encoded by the ADAM2 gene. This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. This gene is mapped to 8p11.2.
  • Specifications :

    Western blot: 0.5-1 µg/mL
  • UniProt :

    Q99965
  • Host :

    Rabbit
  • Reactivity :

    Human, Mouse, Rat
  • Immunogen :

    Amino acids 231-274 (WIDENKIATTGEANELLHTFLRWKTSYLVLRPHDVAFLLVYREK) from the human protein were used as the immunogen for the ADAM2 antibody.
  • Clonality :

    Polyclonal
  • Isotype :

    IgG
  • Applications :

    WB
  • Purity :

    Antigen affinity
  • Format :

    Antigen affinity purified
  • Buffer :

    Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
  • Reconstitution :

    After reconstitution, the ADAM2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Limitations :

    This ADAM2 antibody is available for research use only.
  • Storage Conditions :

    After reconstitution, the ADAM2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Formulation :

    0.5 mg/mL if reconstituted with 0.2ml sterile DI water
  • Applications Notes :

    Optimal dilution of the ADAM2 antibody should be determined by the researcher.
  • CAS Number :

    9007-83-4
  • Image Legend :

    Western blot testing of 1) rat testis, 2) mouse testis and 3) MCF7 lysate with ADAM2 antibody at 0.5ug/ml. Predicted molecular weight ~82 kDa, but can be observed at ~100 kDa.

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide