FDCSP Antibody

CAT:
800-R32777
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
FDCSP Antibody - image 1

FDCSP Antibody

  • Description :

    FDC-SP or follicular dendritic cell-secreted protein, is a small, secreted protein, located on chromosome 4 in humans. FDC-SP is a 68-amino acid protein containing a signal peptide at its N terminus, which is used for directing the transport of the protein. This protein specifically binds to activated B cells, and functions as a regulator of antibody responses. It is also thought to contribute to tumor metastases by promoting cancer cell migration and invasion.
  • CAS Number :

    9007-83-4
  • Specifications :

    Immunhistochemistry (FFPE) : 1-2 µg/mL, Immunofluorsecence (FFPE) : 5 µg/mL
  • UniProt :

    Q8NFU4
  • Host :

    Rabbit
  • Reactivity :

    Human
  • Immunogen :

    Amino acids 18-51 (FPVSQDQEREKRSISDSDELASGFFVFPYPYPFR) from the human protein were used as the immunogen for the FDCSP antibody.
  • Clonality :

    Polyclonal
  • Isotype :

    IgG
  • Applications :

    IHC-P, IF
  • Purity :

    Antigen affinity
  • Format :

    Antigen affinity purified
  • Buffer :

    Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
  • Reconstitution :

    After reconstitution, the FDCSP antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Limitations :

    This FDCSP antibody is available for research use only.
  • Storage Conditions :

    After reconstitution, the FDCSP antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Formulation :

    0.5 mg/mL if reconstituted with 0.2ml sterile DI water
  • Applications Notes :

    Optimal dilution of the FDCSP antibody should be determined by the researcher.
  • Location :

    Cytoplasmic, membranous, secreted
  • Image Legend :

    Immunofluorescent staining of FFPE human tonsil tissue with FDCSP antibody (green) and DAPI nuclear stain (blue) . HIER: steam section in pH8 EDTA buffer for 20 min.

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide