FDCSP Antibody

• Description :

  FDC-SP or follicular dendritic cell-secreted protein, is a small, secreted protein, located on chromosome 4 in humans. FDC-SP is a 68-amino acid protein containing a signal peptide at its N terminus, which is used for directing the transport of the protein. This protein specifically binds to activated B cells, and functions as a regulator of antibody responses. It is also thought to contribute to tumor metastases by promoting cancer cell migration and invasion.

• Specifications :

  Immunhistochemistry (FFPE) : 1-2 µg/mL, Immunofluorsecence (FFPE) : 5 µg/mL

• UniProt :

  Q8NFU4

• Host :

  Rabbit

• Reactivity :

  Human

• Immunogen :

  Amino acids 18-51 (FPVSQDQEREKRSISDSDELASGFFVFPYPYPFR) from the human protein were used as the immunogen for the FDCSP antibody.

• Clonality :

  Polyclonal

• Isotype :

  IgG

• Applications :

  IHC-P, IF

• Purity :

  Antigen affinity

• Format :

  Antigen affinity purified

• Buffer :

  Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

• Reconstitution :

  After reconstitution, the FDCSP antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations :

  This FDCSP antibody is available for research use only.

• Storage Conditions :

  After reconstitution, the FDCSP antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation :

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes :

  Optimal dilution of the FDCSP antibody should be determined by the researcher.

• CAS Number :

  9007-83-4

• Location :

  Cytoplasmic, membranous, secreted

• Image Legend :

  Immunofluorescent staining of FFPE human tonsil tissue with FDCSP antibody (green) and DAPI nuclear stain (blue) . HIER: steam section in pH8 EDTA buffer for 20 min.