FDCSP Antibody
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


FDCSP Antibody
Description :
FDC-SP or follicular dendritic cell-secreted protein, is a small, secreted protein, located on chromosome 4 in humans. FDC-SP is a 68-amino acid protein containing a signal peptide at its N terminus, which is used for directing the transport of the protein. This protein specifically binds to activated B cells, and functions as a regulator of antibody responses. It is also thought to contribute to tumor metastases by promoting cancer cell migration and invasion.CAS Number :
9007-83-4Specifications :
Immunhistochemistry (FFPE) : 1-2 µg/mL, Immunofluorsecence (FFPE) : 5 µg/mLUniProt :
Q8NFU4Host :
RabbitReactivity :
HumanImmunogen :
Amino acids 18-51 (FPVSQDQEREKRSISDSDELASGFFVFPYPYPFR) from the human protein were used as the immunogen for the FDCSP antibody.Clonality :
PolyclonalIsotype :
IgGApplications :
IHC-P, IFPurity :
Antigen affinityFormat :
Antigen affinity purifiedBuffer :
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azideReconstitution :
After reconstitution, the FDCSP antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.Limitations :
This FDCSP antibody is available for research use only.Storage Conditions :
After reconstitution, the FDCSP antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.Formulation :
0.5 mg/mL if reconstituted with 0.2ml sterile DI waterApplications Notes :
Optimal dilution of the FDCSP antibody should be determined by the researcher.Location :
Cytoplasmic, membranous, secretedImage Legend :
Immunofluorescent staining of FFPE human tonsil tissue with FDCSP antibody (green) and DAPI nuclear stain (blue) . HIER: steam section in pH8 EDTA buffer for 20 min.

