ABCA4 Antibody

• Description:

  ABCA4 (ATP-Binding Cassette, Subfamily A, Member 4), also known as ABCR, is a protein which in humans is encoded by the ABCA4 gene. ABCA4 is a member of the ATP-binding cassette transporter gene sub-family A (ABC1) found exclusively in multicellular eukaryotes. Using a whole genome radiation hybrid panel, this gene is mapped to 1p21-p13. And this gene is expressed exclusively in retina photoreceptor cells, indicating the gene product mediates transport of an essental molecule across the photoreceptor cell membrane. Additionally, it is showed by immunofluorescence microscopy and Western blot analysis that ABCR is present in foveal and peripheral cone, as well as rod, photoreceptors. The results suggested that the loss in central vision experienced by patients with Stargardt macular dystrophy arises directly from ABCR-mediated foveal cone degeneration.

• Specifications:

  Western blot: 0.5-1 µg/mL

• UniProt:

  P78363

• Host:

  Rabbit

• Reactivity:

  Human, Mouse, Rat

• Immunogen:

  Amino acids 1890-1927 (FLLTLLVQRHFFLSQWIAEPTKEPIVDEDDDVAEERQR) from the human protein were used as the immunogen for the ABCA4 antibody.

• Clonality:

  Polyclonal

• Isotype:

  IgG

• Applications:

  WB

• Purity:

  Antigen affinity

• Format:

  Antigen affinity purified

• Buffer:

  Lyophilized from 1X PBS with 2% Trehalose

• Reconstitution:

  After reconstitution, the ABCA4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations:

  This ABCA4 antibody is available for research use only.

• Storage Conditions:

  After reconstitution, the ABCA4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation:

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes:

  Optimal dilution of the ABCA4 antibody should be determined by the researcher.

• CAS Number:

  9007-83-4

• Image Legend:

  Western blot testing of 1) human HepG2, 2) rat eye and 3) mouse eye lysate with ABCA4 antibody at 0.5ug/ml. Predicted molecular weight ~256 kDa but may be observed at higher molecular weights due to glycosylation.