LMO1 Antibody
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


LMO1 Antibody
Description:
Rhombotin-1 is a protein that in humans is encoded by the LMO1 gene. This locus encodes a transcriptional regulator that contains two cysteine-rich LIM domains but lacks a DNA-binding domain. LIM domains may play a role in protein interactions; thus the encoded protein may regulate transcription by competitively binding to specific DNA-binding transcription factors. Alterations at this locus have been associated with acute lymphoblastic T-cell leukemia. Chromosomal rearrangements have been observed between this locus and at least two loci, the delta subunit of the T-cell antigen receptor gene and the LIM domain binding 1 gene. Alternatively spliced transcript variants have been described.Specifications:
Western blot: 0.5-1 µg/mLUniProt:
P25800Host:
RabbitReactivity:
Human, Mouse, RatImmunogen:
Amino acids 127-156 (DKFFLKNNMILCQMDYEEGQLNGTFESQVQ) from the human protein were used as the immunogen for the LMO1 antibody.Clonality:
PolyclonalIsotype:
IgGApplications:
WBPurity:
Antigen affinityFormat:
Antigen affinity purifiedBuffer:
Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azideReconstitution:
After reconstitution, the LMO1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.Limitations:
This LMO1 antibody is available for research use only.Storage Conditions:
After reconstitution, the LMO1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.Formulation:
0.5 mg/mL if reconstituted with 0.2ml sterile DI waterApplications Notes:
Optimal dilution of the LMO1 antibody should be determined by the researcher.CAS Number:
9007-83-4Image Legend:
Western blot testing of 1) rat brain, 2) mouse NIH3T3 and 3) human HeLa lysate with LMO1 antibody at 0.5ug/ml. Predicted molecular weight ~18 kDa.
