LMO1 Antibody

CAT:
800-R32704
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
LMO1 Antibody - image 1

LMO1 Antibody

  • Description:

    Rhombotin-1 is a protein that in humans is encoded by the LMO1 gene. This locus encodes a transcriptional regulator that contains two cysteine-rich LIM domains but lacks a DNA-binding domain. LIM domains may play a role in protein interactions; thus the encoded protein may regulate transcription by competitively binding to specific DNA-binding transcription factors. Alterations at this locus have been associated with acute lymphoblastic T-cell leukemia. Chromosomal rearrangements have been observed between this locus and at least two loci, the delta subunit of the T-cell antigen receptor gene and the LIM domain binding 1 gene. Alternatively spliced transcript variants have been described.
  • Specifications:

    Western blot: 0.5-1 µg/mL
  • UniProt:

    P25800
  • Host:

    Rabbit
  • Reactivity:

    Human, Mouse, Rat
  • Immunogen:

    Amino acids 127-156 (DKFFLKNNMILCQMDYEEGQLNGTFESQVQ) from the human protein were used as the immunogen for the LMO1 antibody.
  • Clonality:

    Polyclonal
  • Isotype:

    IgG
  • Applications:

    WB
  • Purity:

    Antigen affinity
  • Format:

    Antigen affinity purified
  • Buffer:

    Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
  • Reconstitution:

    After reconstitution, the LMO1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Limitations:

    This LMO1 antibody is available for research use only.
  • Storage Conditions:

    After reconstitution, the LMO1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Formulation:

    0.5 mg/mL if reconstituted with 0.2ml sterile DI water
  • Applications Notes:

    Optimal dilution of the LMO1 antibody should be determined by the researcher.
  • CAS Number:

    9007-83-4
  • Image Legend:

    Western blot testing of 1) rat brain, 2) mouse NIH3T3 and 3) human HeLa lysate with LMO1 antibody at 0.5ug/ml. Predicted molecular weight ~18 kDa.