LMO1 Antibody

• Description :

  Rhombotin-1 is a protein that in humans is encoded by the LMO1 gene. This locus encodes a transcriptional regulator that contains two cysteine-rich LIM domains but lacks a DNA-binding domain. LIM domains may play a role in protein interactions; thus the encoded protein may regulate transcription by competitively binding to specific DNA-binding transcription factors. Alterations at this locus have been associated with acute lymphoblastic T-cell leukemia. Chromosomal rearrangements have been observed between this locus and at least two loci, the delta subunit of the T-cell antigen receptor gene and the LIM domain binding 1 gene. Alternatively spliced transcript variants have been described.

• CAS Number :

  9007-83-4

• Specifications :

  Western blot: 0.5-1 µg/mL

• UniProt :

  P25800

• Host :

  Rabbit

• Reactivity :

  Human, Mouse, Rat

• Immunogen :

  Amino acids 127-156 (DKFFLKNNMILCQMDYEEGQLNGTFESQVQ) from the human protein were used as the immunogen for the LMO1 antibody.

• Clonality :

  Polyclonal

• Isotype :

  IgG

• Applications :

  WB

• Purity :

  Antigen affinity

• Format :

  Antigen affinity purified

• Buffer :

  Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

• Reconstitution :

  After reconstitution, the LMO1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations :

  This LMO1 antibody is available for research use only.

• Storage Conditions :

  After reconstitution, the LMO1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation :

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes :

  Optimal dilution of the LMO1 antibody should be determined by the researcher.

• Image Legend :

  Western blot testing of 1) rat brain, 2) mouse NIH3T3 and 3) human HeLa lysate with LMO1 antibody at 0.5ug/ml. Predicted molecular weight ~18 kDa.