CD119 Antibody / IFNGR1

• Description:

  Interferon gamma receptor 1 (IFNGR1), also known as CD119 (Cluster of Differentiation 119), is a protein that in humans is encoded by the IFNGR1 gene. This gene encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.

• Specifications:

  Western blot: 0.5-1 µg/mL, Flow cytometry: 1-3ug/million cells

• UniProt:

  P15260

• Host:

  Rabbit

• Reactivity:

  Human

• Immunogen:

  Amino acids 108-147 (QKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFH) from the human protein were used as the immunogen for the CD119 antibody.

• Clonality:

  Polyclonal

• Isotype:

  IgG

• Applications:

  WB, FACS

• Purity:

  Antigen affinity

• Format:

  Antigen affinity purified

• Buffer:

  Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

• Reconstitution:

  After reconstitution, the CD119 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations:

  This CD119 antibody is available for research use only.

• Storage Conditions:

  After reconstitution, the CD119 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation:

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes:

  Optimal dilution of the CD119 antibody should be determined by the researcher.

• CAS Number:

  9007-83-4

• Image Legend:

  Western blot testing of human HepG2 cell lysate with CD119 antibody at 0.5ug/ml. Predicted molecular weight: ~54 kDa (unmodified), 80-100 kDa (glycosylated) .