Periplakin Antibody

CAT:
800-R32647
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Periplakin Antibody - image 1

Periplakin Antibody

  • Description:

    Periplakin is a protein that in humans is encoded by the PPL gene. The protein encoded by this gene is a component of desmosomes and of the epidermal cornified envelope in keratinocytes. The N-terminal domain of this protein interacts with the plasma membrane and its C-terminus interacts with intermediate filaments. Through its rod domain, this protein forms complexes with envoplakin. This protein may serve as a link between the cornified envelope and desmosomes as well as intermediate filaments. AKT1/PKB, a protein kinase mediating a variety of cell growth and survival signaling processes, is reported to interact with this protein, suggesting a possible role for this protein as a localization signal in AKT1-mediated signaling.
  • Specifications:

    Western blot: 0.25-0.5 µg/mL, Immunohistochemistry (FFPE) : 2-5 µg/mL, Immunofluorescence (FFPE) : 5 µg/mL, Flow cytometry: 1-3ug/million cells
  • UniProt:

    O60437
  • Host:

    Rabbit
  • Reactivity:

    Human, Mouse, Rat
  • Immunogen:

    Amino acids 1664-1701 (DTGRELSPEEAHRAGLIDWNMFVKLRSQECDWEEISVK) from the human protein were used as the immunogen for the Periplakin antibody.
  • Clonality:

    Polyclonal
  • Isotype:

    IgG
  • Applications:

    WB, IHC-P, IF, FACS
  • Purity:

    Antigen affinity
  • Format:

    Antigen affinity purified
  • Buffer:

    Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
  • Reconstitution:

    After reconstitution, the Periplakin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Limitations:

    This Periplakin antibody is available for research use only.
  • Storage Conditions:

    After reconstitution, the Periplakin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Formulation:

    0.5 mg/mL if reconstituted with 0.2ml sterile DI water
  • Applications Notes:

    Optimal dilution of the Periplakin antibody should be determined by the researcher.
  • CAS Number:

    9007-83-4
  • Location:

    Cytoplasmic, membranous, nuclear
  • Image Legend:

    IHC testing of FFEP human tonsil tissue with Periplakin antibody. Required HIER: steam section in pH8 EDTA for 20 min and allow to cool prior to testing.