SCTR Antibody
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


SCTR Antibody
Description :
Human secretin receptor (gene name SCTR) is a G protein-coupled receptor and belongs to the glucagon-VIP-secretin receptor family. It binds secretin which is the most potent regulator of pancreatic bicarbonate, electrolyte and volume secretion. Secretin and its receptor are suggested to be involved in pancreatic cancer and autism. The SCTR gene is mapped to chromosome 2q14.1 by fluorescence in situ hybridization.Specifications :
Western blot: 0.5-1 µg/mLUniProt :
P47872Host :
RabbitReactivity :
Human, RatImmunogen :
Amino acids 398-440 (EVQKKWQQWHLREFPLHPVASFSNSTKASHLEQSQGTCRTSII) from the human protein were used as the immunogen for the SCTR antibody.Clonality :
PolyclonalIsotype :
IgGApplications :
WBPurity :
Antigen affinityFormat :
Antigen affinity purifiedBuffer :
Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azideReconstitution :
After reconstitution, the SCTR antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.Limitations :
This SCTR antibody is available for research use only.Storage Conditions :
After reconstitution, the SCTR antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.Formulation :
0.5 mg/mL if reconstituted with 0.2ml sterile DI waterApplications Notes :
Differences in protocols and secondary/substrate sensitivity may require the SCTR antibody to be titrated for optimal performance.CAS Number :
9007-83-4Image Legend :
Western blot testing of 1) rat kidney and 2) human SKOV3 lysate with SCTR antibody at 0.5ug/ml. Expected molecular weight: 50-64 kDa depending on glycosylation level.

