E2F4 Antibody

CAT:
800-R32525
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
E2F4 Antibody - image 1

E2F4 Antibody

  • Description :

    E2F4 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. This protein binds to all three of the tumor suppressor proteins pRB, p107 and p130, but with higher affinity to the last two.
  • Specifications :

    Western blot: 0.5-1 µg/mL, IHC (FFPE) : 1-2 µg/mL
  • UniProt :

    Q16254
  • Host :

    Rabbit
  • Reactivity :

    Human, Mouse, Rat
  • Immunogen :

    Amino acids 106-144 (ELQQREQELDQHKVWVQQSIRNVTEDVQNSCLAYVTHED) from the human protein were used as the immunogen for the E2F4 antibody.
  • Clonality :

    Polyclonal
  • Isotype :

    IgG
  • Applications :

    WB, IHC-P
  • Purity :

    Antigen affinity
  • Format :

    Antigen affinity purified
  • Buffer :

    Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
  • Reconstitution :

    After reconstitution, the E2F4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Limitations :

    This E2F4 antibody is available for research use only.
  • Storage Conditions :

    After reconstitution, the E2F4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Formulation :

    0.5 mg/mL if reconstituted with 0.2ml sterile DI water
  • Applications Notes :

    Differences in protocols and secondary/substrate sensitivity may require the E2F4 antibody to be titrated for optimal performance.
  • CAS Number :

    9007-83-4
  • Location :

    Cytoplasmic, nuclear
  • Image Legend :

    Western blot testing of human 1) HeLa, 2) U-2 OS and 3) MCF7 lysate with E2F4 antibody at 0.5ug/ml. Expected molecular weight ~44 kDa (unmodified) and 60-65 kDa (phosphorylated) .

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide