AK1 Antibody / Adenylate Kinase 1 | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS5311949-01	Adenylate Kinase 3 Antibody
MBS8584073-01	Adenylate Kinase 1 Antibody
E38PA5163	Adenylate Kinase 6 Antibody
E38PA6386	Adenylate Kinase 1 Antibody
MBS5311949-02	Adenylate Kinase 3 Antibody
MBS8584073-03	Adenylate Kinase 1 Antibody
MBS8584073-05	Adenylate Kinase 1 Antibody
MBS9430793-02	Adenylate Kinase 6 Antibody
MBS8582959-02	Adenylate Kinase 6 Antibody
MBS8582959-04	Adenylate Kinase 6 Antibody

AK1 Antibody / Adenylate Kinase 1

CAT:

800-R32501

Size:

100 µg

Price:

Ask

For price, please contact [email protected].

AK1 Antibody / Adenylate Kinase 1

Description: This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. This gene is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.
UniProt: P00568
Host: Rabbit
Immunogen: Amino acids 149-189 (RLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTH) from the human protein were used as the immunogen for the AK1 antibody.
Clonality: Polyclonal
Isotype: IgG
Applications: WB, IF, FACS
Format: Antigen affinity purified
Buffer: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Reconstitution: After reconstitution, the AK1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitations: This AK1 antibody is available for research use only.

Complementary Product Range

Our range of products, including AK1 Antibody / Adenylate Kinase 1, falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
R32501	AK1 Antibody / Adenylate Kinase 1
F54385-0.4ML	Adenylate kinase 4 Antibody / AK4
F54385-0.08ML	Adenylate kinase 4 Antibody / AK4
R32502	AK2 Antibody / Adenylate kinase 2
R33214-100UG	Acylglycerol kinase Antibody
RQ6751	Pyruvate Kinase Antibody / PKM2
RQ5558	DCK Antibody / Deoxycytidine kinase
R32499	ADK Antibody / Adenosine kinase
R31966	Pyruvate Kinase Antibody / PKM2
F51508-0.08ML	Pyruvate Kinase Antibody (PKM2)

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on