ACAA2 Antibody
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


ACAA2 Antibody
Description :
3-Ketoacyl-CoA thiolase, mitochondrial, also known as acetyl-Coenzyme A acyltransferase 2, is an acetyl-CoA C-acyltransferase enzyme that in humans is encoded by the ACAA2 gene. The ACAA2 gene encodes a 41.9 kDa protein that is composed of 397 amino acids and contains 88 observed peptides. The encoded protein catalyzes the last step of themitochondrial fatty acid beta oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal. Additionally, ACAA2 has been shown to be a functional BNIP3 binding partner, which provides a possible link between fatty acid metabolism and cell apoptosis.Specifications :
Western blot: 0.5-1 µg/mL, IHC (FFPE) : 1-2 µg/mL, IF/ICC (FFPE) : 2-4 µg/mL, FACS: 1-3ug/10^6 cellsUniProt :
P42765Host :
RabbitReactivity :
Human, Mouse, RatImmunogen :
Amino acids 207-242 (EVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKD from the human protein were used as the immunogen for the ACAA2 antibody.Clonality :
PolyclonalIsotype :
IgGApplications :
WB, IHC-P, FACS, IF/ICCPurity :
Antigen affinityFormat :
Antigen affinity purifiedBuffer :
Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azideReconstitution :
After reconstitution, the ACAA2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.Limitations :
This ACAA2 antibody is available for research use only.Storage Conditions :
After reconstitution, the ACAA2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.Formulation :
0.5 mg/mL if reconstituted with 0.2ml sterile DI waterApplications Notes :
Differences in protocols and secondary/substrate sensitivity may require the ACAA2 antibody to be titrated for optimal performance.CAS Number :
9007-83-4Location :
CytoplasmicImage Legend :
Western blot testing of 1) rat lung, 2) mouse brain and 3) human HeLa lysate with ACAA2 antibody at 0.5ug/ml. Predicted molecular weight ~42 kDa.

