ABCB10 Antibody

• Description :

  ABCB10, also known as M-ABC2, is expressed as a 65-kD nonglycosylated mitochondrial membrane protein. This ABCB10 gene is mapped to 1q42.13. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. And ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White) . This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The function of this mitochondrial protein is unknown.

• Specifications :

  Western blot: 0.5-1 µg/mL

• UniProt :

  Q9NRK6

• Host :

  Rabbit

• Reactivity :

  Human, Rat

• Immunogen :

  Amino acids 640-678 (QRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDR) from the human protein were used as the immunogen for the ABCB10 antibody.

• Clonality :

  Polyclonal

• Isotype :

  IgG

• Applications :

  WB

• Purity :

  Antigen affinity

• Format :

  Antigen affinity purified

• Buffer :

  Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

• Reconstitution :

  Prior to reconstitution, store at 4oC. After reconstitution, the ABCB10 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations :

  This ABCB10 antibody is available for research use only.

• Storage Conditions :

  Prior to reconstitution, store at 4°C. After reconstitution, the ABCB10 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation :

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes :

  Optimal dilution of the ABCB10 antibody should be determined by the researcher.

• CAS Number :

  9007-83-4

• Image Legend :

  Western blot testing of 1) rat muscle, 2) human COLO320, 3) human 22RV1 and 4) human PANC lysate with ABCB10 antibody at 0.5ug/ml. Expected molecular weight: ~79 kDa (full), ~65 kDa (cleaved mitochondrial targeting sequence (amino acids 1-105) ) .