TIP47 Antibody / Perilipin 3 / M6PRBP1

• Description:

  Mannose-6-phosphate receptor binding protein 1 (M6PRBP1), also known as Perilipin 3 (PLN3) or TIP47, is a protein which in humans is encoded by the M6PRBP1 gene. Mannose 6-phophate receptors (MPRs) deliver lysosomal hydrolase from the Golgi to endosomes and then return to the Golgi complex. The protein encoded by this gene interacts with the cytoplasmic domains of both cation-independent and cation-dependent MPRs, and is required for endosome-to-Golgi transport. This protein also binds directly to the GTPase RAB9 (RAB9A), a member of the RAS oncogene family. The interaction with RAB9 has been shown to increase the affinity of this protein for its cargo. Multiple transcript variants encoding different isoforms have been found for this gene.

• UniProt:

  O60664

• Host:

  Rabbit

• Immunogen:

  Amino acids ESRALTMFRDIAQQLQATCTSLGSSIQGLPTNVKDQVQQARRQ were used as the immunogen for the Perilipin 3 antibody.

• Clonality:

  Polyclonal

• Isotype:

  IgG

• Applications:

  WB, IHC-P

• Format:

  Antigen affinity purified

• Buffer:

  0.5mg/ml if reconstituted with 0.2ml sterile DI water

• Reconstitution:

  Prior to reconstitution, store at 4oC. After reconstitution, the Perilipin 3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations:

  This Perilipin 3 antibody is available for research use only.

• CAS Number:

  9007-83-4