SECTM1 Antibody

• Description :

  SECTM1B is also known as Sectm1 or K12. Secreted and transmembrane protein 1 is a protein that in humans is encoded by the SECTM1 gene. This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes.

• CAS Number :

  9007-83-4

• Specifications :

  Western blot: 0.1-0.5 µg/mL

• UniProt :

  Q9JL59

• Host :

  Rabbit

• Reactivity :

  Mouse

• Immunogen :

  Amino acids KLHGFQAEFKNFNLTVNAADRQKTEDLPVTKVPDK of mouse SECTM1 were used as the immunogen for the SECTM1 antibody.

• Clonality :

  Polyclonal

• Isotype :

  IgG

• Applications :

  WB

• Purity :

  Antigen affinity

• Format :

  Antigen affinity purified

• Buffer :

  Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

• Reconstitution :

  After reconstitution, the SECTM1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations :

  This SECTM1 antibody is available for research use only.

• Storage Conditions :

  After reconstitution, the SECTM1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation :

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes :

  Optimal dilution of the SECTM1 antibody should be determined by the researcher.

• Image Legend :

  Western blot testing of mouse HEPA cell lysate with SECTM1 antibody. Expected/observed molecular weight ~23 kDa.