SECTM1 Antibody

CAT:
800-R32327
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
SECTM1 Antibody - image 1

SECTM1 Antibody

  • Description :

    SECTM1B is also known as Sectm1 or K12. Secreted and transmembrane protein 1 is a protein that in humans is encoded by the SECTM1 gene. This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes.
  • CAS Number :

    9007-83-4
  • Specifications :

    Western blot: 0.1-0.5 µg/mL
  • UniProt :

    Q9JL59
  • Host :

    Rabbit
  • Reactivity :

    Mouse
  • Immunogen :

    Amino acids KLHGFQAEFKNFNLTVNAADRQKTEDLPVTKVPDK of mouse SECTM1 were used as the immunogen for the SECTM1 antibody.
  • Clonality :

    Polyclonal
  • Isotype :

    IgG
  • Applications :

    WB
  • Purity :

    Antigen affinity
  • Format :

    Antigen affinity purified
  • Buffer :

    Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
  • Reconstitution :

    After reconstitution, the SECTM1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Limitations :

    This SECTM1 antibody is available for research use only.
  • Storage Conditions :

    After reconstitution, the SECTM1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Formulation :

    0.5 mg/mL if reconstituted with 0.2ml sterile DI water
  • Applications Notes :

    Optimal dilution of the SECTM1 antibody should be determined by the researcher.
  • Image Legend :

    Western blot testing of mouse HEPA cell lysate with SECTM1 antibody. Expected/observed molecular weight ~23 kDa.

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide