STING Antibody
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
STING Antibody
Description :
Transmembrane protein 173, also called STING, is a protein that in humans is encoded by the TMEM173 gene. This gene encodes a five transmembrane protein that functions as a major regulator of the innate immune response to viral and bacterial infections. The encoded protein is a pattern recognition receptor that detects cytosolic nucleic acids and transmits signals that activate type I interferon responses. Also the encoded protein has been shown to play a role in apoptotic signaling by associating with type II major histocompatibility complex. Mutations in this gene are the cause of infantile-onset STING-associated vasculopathy. Alternate splicing results in multiple transcript variants.Specifications :
Western blot: 0.1-0.5 µg/mL, IHC (FFPE) : 0.5-1 µg/mLUniProt :
Q86WV6Host :
RabbitReactivity :
HumanImmunogen :
Amino acids RLEQAKLFCRTLEDILADAPESQNNCRLIAYQE of human STING were used as the immunogen for the STING antibody.Clonality :
PolyclonalIsotype :
IgGApplications :
WB, IHC-PPurity :
Antigen affinityFormat :
Antigen affinity purifiedBuffer :
Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azideReconstitution :
After reconstitution, the STING antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.Limitations :
This STING antibody is available for research use only.Storage Conditions :
After reconstitution, the STING antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.Formulation :
0.5 mg/mL if reconstituted with 0.2ml sterile DI waterApplications Notes :
Optimal dilution of the STING antibody should be determined by the researcher.CAS Number :
9007-83-4Location :
CytoplasmicImage Legend :
Western blot testing of human 1) A549 and 2) HeLa cell lysate with STING antibody. Predicted molecular weight ~42/35 kDa.
