STING Antibody

• Description:

  Transmembrane protein 173, also called STING, is a protein that in humans is encoded by the TMEM173 gene. This gene encodes a five transmembrane protein that functions as a major regulator of the innate immune response to viral and bacterial infections. The encoded protein is a pattern recognition receptor that detects cytosolic nucleic acids and transmits signals that activate type I interferon responses. Also the encoded protein has been shown to play a role in apoptotic signaling by associating with type II major histocompatibility complex. Mutations in this gene are the cause of infantile-onset STING-associated vasculopathy. Alternate splicing results in multiple transcript variants.

• Specifications:

  Western blot: 0.1-0.5 µg/mL, IHC (FFPE) : 0.5-1 µg/mL

• UniProt:

  Q86WV6

• Host:

  Rabbit

• Reactivity:

  Human

• Immunogen:

  Amino acids RLEQAKLFCRTLEDILADAPESQNNCRLIAYQE of human STING were used as the immunogen for the STING antibody.

• Clonality:

  Polyclonal

• Isotype:

  IgG

• Applications:

  WB, IHC-P

• Purity:

  Antigen affinity

• Format:

  Antigen affinity purified

• Buffer:

  Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

• Reconstitution:

  After reconstitution, the STING antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations:

  This STING antibody is available for research use only.

• Storage Conditions:

  After reconstitution, the STING antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation:

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes:

  Optimal dilution of the STING antibody should be determined by the researcher.

• CAS Number:

  9007-83-4

• Location:

  Cytoplasmic

• Image Legend:

  Western blot testing of human 1) A549 and 2) HeLa cell lysate with STING antibody. Predicted molecular weight ~42/35 kDa.