FOXA3 Antibody

• Description:

  Hepatocyte nuclear factor 3-gamma (HNF-3G), also known as forkhead box protein A3 (FOXA3) or transcription factor 3G (TCF-3G), is a protein that in humans is encoded by the FOXA3 gene. This gene is mapped to 19q13.32. HNF-3G is a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved.

• Specifications:

  Western blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 2-5 µg/mL, Immunofluorescence: 5 µg/mL, Flow cytometry: 1-3ug/million cells

• UniProt:

  P55318

• Host:

  Rabbit

• Reactivity:

  Human, Mouse, Rat

• Immunogen:

  Amino acids ELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGF of human FOXA3 were used as the immunogen for the FOXA3 antibody.

• Clonality:

  Polyclonal

• Isotype:

  IgG

• Applications:

  WB, IHC-P, IF, FACS

• Purity:

  Antigen affinity

• Format:

  Antigen affinity purified

• Buffer:

  Lyophilized from 1X PBS with 2% Trehalose

• Reconstitution:

  After reconstitution, the FOXA3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations:

  This FOXA3 antibody is available for research use only.

• Storage Conditions:

  After reconstitution, the FOXA3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation:

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes:

  Optimal dilution of the FOXA3 antibody should be determined by the researcher.

• CAS Number:

  9007-83-4

• Location:

  Nuclear

• Image Legend:

  Immunofluorescent staining of FFPE human U-2 OS cells with FOXA3 antibody (green) and Beta Tubulin mAb (red) . HIER: steam section in pH6 citrate buffer for 20 min.