PAR2 Antibody / F2RL1 / Thrombin Receptor-like 1 | Gentaur

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Product Documents

Datasheet

Alternative Products

Cat	Name
A01081	Anti-PAR2 F2RL1 Antibody
PAV2933	Rabbit Anti-PAR2/F2RL1 Polyclonal Antibody
APR15902G	Polyclonal F2RL1 / PAR2 Antibody (C-Terminus)
APR15903G	Polyclonal F2RL1 / PAR2 Antibody (N-Terminus)
PB9700	Anti-PAR2/F2RL1 Antibody Picoband™
abx302345-100g	Proteinase-Activated Receptor 2 / PAR2 (F2RL1) Antibody
abx103064-200l	Proteinase-Activated Receptor 2 / PAR2 (F2RL1) Antibody
abx111705-100l	Proteinase-Activated Receptor 2 / PAR2 (F2RL1) Antibody
abx376424-96tests	Proteinase-Activated Receptor 2 / PAR2 (F2RL1) Antibody
abx240187-50l	Proteinase-Activated Receptor 2 / PAR2 (F2RL1) Antibody

PAR2 Antibody / F2RL1 / Thrombin Receptor-like 1

CAT:

800-R32144

Size:

100 µg

Price:

Ask

For price, please contact [email protected].

PAR2 Antibody / F2RL1 / Thrombin Receptor-like 1

Description: Protease activated receptor 2 (PAR2), also known ascoagulation factor II (thrombin) receptor-like 1 (F2RL1) or G-protein coupled receptor 11 (GPR11), is a protein that in humans is encoded by the F2RL1 gene. F2RL1 is a member of the large family of 7-transmembrane-region receptors that couple to guanosine-nucleotide-binding proteins. F2RL1 is also a member of the protease-activated receptor family. It is activated by trypsin, but not by thrombin. It is activated by proteolytic cleavage of its extracellular amino terminus. The new amino terminus functions as a tethered ligand and activates the receptor. The F2RL1 gene contains two exons and is widely expressed in human tissues. Additionally, PAR2 modulates inflammatory responses and acts as a sensor for proteolytic enzymes generated during infection.
UniProt: P55085
Host: Rabbit
Immunogen: Amino acids HDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKS of human F2RL1/PAR2 were used as the immunogen for the PAR2 antibody.
Clonality: Polyclonal
Isotype: IgG
Applications: WB
Format: Antigen affinity purified
Buffer: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Reconstitution: After reconstitution, the PAR2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Limitations: This PAR2 antibody is available for research use only.

Complementary Product Range

Our range of products, including PAR2 Antibody / F2RL1 / Thrombin Receptor-like 1, falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Related Products

Cat	Name
R32144	PAR2 Antibody / F2RL1 / Thrombin Receptor-like 1
F54788-0.4ML	ARHGDIA Antibody / RHOGDI Antibody
F54788-0.08ML	ARHGDIA Antibody / RHOGDI Antibody
V2153-20UG	Lambda Light Chain Antibody / Lambda Antibody
V3151-100UG	Lambda Light Chain Antibody / Lambda Antibody
V3151-20UG	Lambda Light Chain Antibody / Lambda Antibody
V3151SAF-100UG	Lambda Light Chain Antibody / Lambda Antibody
V3152-100UG	Lambda Light Chain Antibody / Lambda Antibody
V3262-20UG	Lambda Light Chain Antibody / Lambda Antibody
V9032-20UG	Lambda Light Chain Antibody / Lambda Antibody

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on