HSPA2 Antibody
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


HSPA2 Antibody
Description:
HSPA2 (heat shock 70kDa protein 2) is also known as HEAT-SHOCK PROTEIN, 70-KD, 2, HSP70-2, HEAT-SHOCK PROTEIN, 70-KD, 3 or HSP70-3. Analysis of the sequence indicated that HSPA2 is the human homolog of the murine Hsp70-2 gene, with 91.7% identity in the nucleotide coding sequence and 98.2% in the corresponding amino acid sequence. HSPA2 has less amino acid homology to the other members of the human HSP70 gene family. HSPA2 is constitutively expressed in most tissues, with very high levels in testis and skeletal muscle. The HSPA2 gene is located on chromosome 14q22-q24. Immunohistochemical analysis detected weak expression of HSPA2 in spermatocytes and stronger expression in spermatids and in the tail of mature sperm. HSPA2 may be critical to sperm maturation through its role as a protein chaperone.Specifications:
Western blot: 0.1-0.5 µg/mL, Immunohistochemistry (FFPE) : 0.5-1 µg/mL, Immunofluorescence/Immunocytochemistry: 2-4 µg/mL, Flow cytometry: 1-3ug/10^6 cellsUniProt:
P54652Host:
RabbitReactivity:
Human, Mouse, RatImmunogen:
Amino acids KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK of human HSPA2 were used as the immunogen for the HSPA2 antibody.Clonality:
PolyclonalIsotype:
IgGApplications:
WB, IHC-P, FACS, IF/ICCPurity:
Antigen affinityFormat:
Antigen affinity purifiedBuffer:
Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azideReconstitution:
After reconstitution, the HSPA2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.Limitations:
This HSPA2 antibody is available for research use only.Storage Conditions:
After reconstitution, the HSPA2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.Formulation:
0.5 mg/mL if reconstituted with 0.2ml sterile DI waterApplications Notes:
Optimal dilution of the HSPA2 antibody should be determined by the researcher.CAS Number:
9007-83-4Location:
Nuclear, cytoplasmicImage Legend:
Western blot testing of 1) rat liver, 2) rat thymus, 3) rat testis, 4) mouse liver, 5) mouse kidney, 6) human HeLa, 7) human MCF7 and 8) human A375 and 9) mouse NIH3T3 lysate with HSPA2 antibody. Expected/observed molecular weight ~70 kDa.
