GRK5 Antibody

• Description:

  G protein-coupled receptor kinase 5 is an enzyme that in humans is encoded by the GRK5 gene. This gene encodes a member of the guanine nucleotide-binding protein (G protein) -coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs) .

• Specifications:

  Western blot: 0.1-0.5 µg/mL, Immunohistochemistry (FFPE) : 0.5-1 µg/mL

• UniProt:

  P34947

• Host:

  Rabbit

• Reactivity:

  Human, Mouse, Rat

• Immunogen:

  Amino acids KREEVDRRVLETEEVYSHKFSEEAKSICKMLLTKDAK of human GRK5 were used as the immunogen for the GRK5 antibody.

• Clonality:

  Polyclonal

• Isotype:

  IgG

• Applications:

  WB, IHC-P

• Purity:

  Antigen affinity

• Format:

  Antigen affinity purified

• Buffer:

  Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

• Reconstitution:

  After reconstitution, the GRK5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations:

  This GRK5 antibody is available for research use only.

• Storage Conditions:

  After reconstitution, the GRK5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation:

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes:

  Optimal dilution of the GRK5 antibody should be determined by the researcher.

• CAS Number:

  9007-83-4

• Location:

  Nuclear, cytoplasmic

• Image Legend:

  Western blot testing of 1) human HepG2, 2) human HeLa, 3) human A549, 4) rat heart and 5) mouse heart tissue lysate with GRK5 antibody. Expected molecular weight ~68 kDa.