GRK5 Antibody

CAT:
800-R32073
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
GRK5 Antibody - image 1

GRK5 Antibody

  • Description :

    G protein-coupled receptor kinase 5 is an enzyme that in humans is encoded by the GRK5 gene. This gene encodes a member of the guanine nucleotide-binding protein (G protein) -coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs) .
  • Specifications :

    Western blot: 0.1-0.5 µg/mL, Immunohistochemistry (FFPE) : 0.5-1 µg/mL
  • UniProt :

    P34947
  • Host :

    Rabbit
  • Reactivity :

    Human, Mouse, Rat
  • Immunogen :

    Amino acids KREEVDRRVLETEEVYSHKFSEEAKSICKMLLTKDAK of human GRK5 were used as the immunogen for the GRK5 antibody.
  • Clonality :

    Polyclonal
  • Isotype :

    IgG
  • Applications :

    WB, IHC-P
  • Purity :

    Antigen affinity
  • Format :

    Antigen affinity purified
  • Buffer :

    Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
  • Reconstitution :

    After reconstitution, the GRK5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Limitations :

    This GRK5 antibody is available for research use only.
  • Storage Conditions :

    After reconstitution, the GRK5 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Formulation :

    0.5 mg/mL if reconstituted with 0.2ml sterile DI water
  • Applications Notes :

    Optimal dilution of the GRK5 antibody should be determined by the researcher.
  • CAS Number :

    9007-83-4
  • Location :

    Nuclear, cytoplasmic
  • Image Legend :

    Western blot testing of 1) human HepG2, 2) human HeLa, 3) human A549, 4) rat heart and 5) mouse heart tissue lysate with GRK5 antibody. Expected molecular weight ~68 kDa.

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide