RRM2 Antibody

• Description:

  Ribonucleoside-diphosphate reductase subunit M2, also known as ribonucleotide reductase small subunit, is an enzyme that in humans is encoded by the RRM2 gene. It is mapped to 2p25-p24. This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms which differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X.

• Specifications:

  Western blot: 0.1-0.5 µg/mL, IHC (FFPE) : 0.5-1 µg/mL

• UniProt:

  P31350

• Host:

  Rabbit

• Reactivity:

  Human, Mouse, Rat

• Immunogen:

  Amino acids MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENT of human RRM2 were used as the immunogen for the RRM2 antibody.

• Clonality:

  Polyclonal

• Isotype:

  IgG

• Applications:

  WB, IHC-P

• Purity:

  Antigen affinity

• Format:

  Antigen affinity purified

• Buffer:

  Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

• Reconstitution:

  After reconstitution, the RRM2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations:

  This RRM2 antibody is available for research use only.

• Storage Conditions:

  After reconstitution, the RRM2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation:

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes:

  Optimal dilution of the RRM2 antibody should be determined by the researcher.

• CAS Number:

  9007-83-4

• Location:

  Cytoplasmic, membrane

• Image Legend:

  Western blot testing of 1) rat heart, 2) mouse heart, 3) human A431 and 4) human HeLa lysate with RRM2 antibody. Expected/observed molecular weight: 45~50 kDa.