Kv1.4 Antibody

• Description:

  Potassium voltage-gated channel subfamily A member 4, also known as Kv1.4 or PCN2, mediates transmembrane potassium transport in excitable membranes. Forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. [UniProt]

• Specifications:

  Western blot: 0.1-0.5 µg/mL, IHC (FFPE) : 0.5-1 µg/mL

• UniProt:

  P22459

• Host:

  Rabbit

• Reactivity:

  Human

• Immunogen:

  Amino acids SEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAK of human Kv1.4 were used as the immunogen for the Kv1.4 antibody.

• Clonality:

  Polyclonal

• Isotype:

  IgG

• Applications:

  WB, IHC-P

• Purity:

  Antigen affinity

• Format:

  Antigen affinity purified

• Buffer:

  Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

• Reconstitution:

  After reconstitution, the Kv1.4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations:

  This Kv1.4 antibody is available for research use only.

• Storage Conditions:

  After reconstitution, the Kv1.4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation:

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes:

  Optimal dilution of the Kv1.4 antibody should be determined by the researcher.

• CAS Number:

  9007-83-4

• Location:

  Cytoplasmic

• Image Legend:

  Western blot testing of human 1) HeLa, 2) COLO320, 3) HT1080 and 4) PANC cell lysate with Kv1.4 antibody. Expected/observed molecular weight ~73 kDa.