IGFBP2 Antibody

CAT:
800-R31993
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
IGFBP2 Antibody - image 1

IGFBP2 Antibody

  • Description:

    The superfamily of insulin-like growth factor (IGF) binding proteins include the six high-affinity IGF binding proteins (IGFBP) and at least four additional low-affinity binding proteins referred to as IGFBP related proteins (IGFBP-rP) . All IGFBP superfamily members are cysteine-rich proteins with conserved cysteine residues, which are clustered in the amino- and carboxy-terminal thirds of the molecule. IGFBPs modulate the biological activities of IGF proteins. Some IGFBPs may also have intrinsic bioactivity that is independent of their ability to bind IGF proteins. Post-translational modifications of IGFBPs, including glycosylation, phosphorylation and proteolysis, have been shown to modify the affinities of the binding proteins to IGF. Human IGFBP-2 cDNA encodes a 328 amino acid (aa) residue precursor protein with a putative 39 aa residue signal peptide that is processed to generate the 289 aa residue mature protein. IGFBP-2 contains an integrin receptor recognition sequence (RGD sequence) but lacks potential N-linked glycosylation sites. During development, IGFBP-2 is expressed in a number of tissues. The highest expression level is found in the central nervous system. In adults, high expression levels are also detected in the central nervous system and in a number of reproductive tissues. IGFBP-2 binds preferentially to IGF II, exhibiting a 2-10 fold higher affinity for IGF II than for IGF I.
  • Specifications:

    Western blot: 0.1-0.5 µg/mL
  • UniProt:

    P18065
  • Host:

    Rabbit
  • Reactivity:

    Human, Rat
  • Immunogen:

    Amino acids QQELDQVLERISTMRLPDERGPLEHLYSLH of human IGFBP2 were used as the immunogen for the IGFBP2 antibody.
  • Clonality:

    Polyclonal
  • Isotype:

    IgG
  • Applications:

    WB
  • Purity:

    Antigen affinity
  • Format:

    Antigen affinity purified
  • Buffer:

    Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
  • Reconstitution:

    After reconstitution, the IGFBP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Limitations:

    This IGFBP2 antibody is available for research use only.
  • Storage Conditions:

    After reconstitution, the IGFBP2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Formulation:

    0.5 mg/mL if reconstituted with 0.2ml sterile DI water
  • Applications Notes:

    Optimal dilution of the IGFBP2 antibody should be determined by the researcher.
  • CAS Number:

    9007-83-4
  • Location:

    Cytoplasmic
  • Image Legend:

    Western blot testing of 1) rat brain, 2) rat liver, and 3) human placenta lysate with IGFBP2 antibody. Predicted/observed molecular weight ~35 kDa.