LCAT Antibody
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


LCAT Antibody
Description :
LCAT (Lecithin: Cholesterol Acyltransferase), is an enzyme that converts free cholesterol into cholesteryl ester. Azoulay et al. (1987) used a cDNA clone corresponding to LCAT to assign the locus to 16q22 through the analysis of DNA from somatic cell hybrids and in situ hybridization. LCAT plays an important role in lipoprotein metabolism, especially in the process termed 'reverse cholesterol transport.' The enzyme is synthesized in the liver and circulates in blood plasma as a complex with components of high density lipoprotein (HDL) . Cholesterol from peripheral cells is transferred to HDL particles, esterified through the action of LCAT on HDL, and incorporated into the core of the lipoprotein. The cholesterol ester is thereby transported to the liver (Jonas, 2000) .Specifications :
Western blot: 0.1-0.5 µg/mLUniProt :
P16301Host :
RabbitReactivity :
Human, Mouse, RatImmunogen :
Amino acids QPVHLLPMNETDHLNMVFSNKTLEHINAILLGAYR of mouse LCAT were used as the immunogen for the LCAT antibody.Clonality :
PolyclonalIsotype :
IgGApplications :
WBPurity :
Antigen affinityFormat :
Antigen affinity purifiedBuffer :
Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azideReconstitution :
After reconstitution, the LCAT antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.Limitations :
This LCAT antibody is available for research use only.Storage Conditions :
After reconstitution, the LCAT antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.Formulation :
0.5 mg/mL if reconstituted with 0.2ml sterile DI waterApplications Notes :
Optimal dilution of the LCAT antibody should be determined by the researcher.CAS Number :
9007-83-4Image Legend :
Western blot testing of 1) rat brain, 2) mouse testis, 3) human HepG2 and 4) human HeLa lysate with LCAT antibody. Observed molecular weight: 50~75 kDa depending on glycosylation level.
