IDO1 Antibody

• Description :

  IDO1 (INDOLEAMINE 2,3-DIOXYGENASE), INDO or IDO, is an immunomodulatory enzyme produced by some alternatively activated macrophages and other immunoregulatory cells. This enzyme catalyzes the degradation of the essential amino acid L-tryptophan to N-formyl-kynurenine. By fluorescence in situ hybridization, the assignment is narrowed to chromosome 8p12-p11. INDO Interferon-gamma has an antiproliferative effect on many tumor cells and inhibits intracellular pathogens such as Toxoplasma and chlamydia, at least partly because of the induction of indoleamine 2,3-dioxygenase. During inflammation, IDO is upregulated in dendritic cells and phagocytes by proinflammatory stimuli, most notably IFNG, and the enzyme then uses superoxide as a 'cofactor' for oxidative cleavage of the indole ring of tryptophan, yielding an intermediate that deformylates to L-kynurenine.

• Specifications :

  Western blot: 0.1-0.5 µg/mL, Immunohistochemistry (FFPE) : 0.5-1 µg/mL, Immunocytochemistry (FFPE) : 1-2 µg/mL, Flow cytometry: 1-2ug/million cells, Immunofluorescence (FFPE) : 2-4 µg/mL

• UniProt :

  P14902

• Host :

  Rabbit

• Reactivity :

  Human

• Immunogen :

  Amino acids NDWMFIAKHLPDLIESGQLRERVEKLNMLSIDH of human IDO1 were used as the immunogen for the IDO1 antibody.

• Clonality :

  Polyclonal

• Isotype :

  IgG

• Applications :

  WB, IHC-P, ICC, IF, FACS

• Purity :

  Antigen affinity

• Format :

  Antigen affinity purified

• Buffer :

  Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

• Reconstitution :

  After reconstitution, the IDO1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations :

  This IDO1 antibody is available for research use only.

• Storage Conditions :

  After reconstitution, the IDO1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation :

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes :

  Optimal dilution of the IDO1 antibody should be determined by the researcher.

• CAS Number :

  9007-83-4

• Location :

  Cytoplasmic

• Image Legend :

  Immunofluorescent staining of FFPE human A431 cells with IDO1 antibody (green) and DAPI nuclear stain (blue) . HIER: steam section in pH6 citrate buffer for 20 min.