BMP2 Antibody

• Description:

  BMP2 is also known as Bone morphogenetic protein 2 or BMP2A. It is mapped to 20p12. The protein encoded by this gene belongs to the transforming growth factor-beta (TGFB) superfamily.BMP-2, like otherbone morphogenetic proteins, plays an important role in the development of bone and cartilage. It is involved in thehedgehog pathway, TGF beta signaling pathway, and incytokine-cytokine receptor interaction. Also, it is involved in cardiac cell differentiation andepithelial to mesenchymal transition. In addition, BMP2A has been suggested as a reasonable candidate for the human condition fibrodysplasia (myositis) ossificans progressiva, on the basis of observations in a Drosophila model.

• Specifications:

  Western blot: 0.1-0.5 µg/mL, IHC (FFPE) : 0.5-1 µg/mL, ELISA: 0.1-0.5 µg/mL (human protein tested) ; request BSA-free format for coating

• UniProt:

  P12643

• Host:

  Rabbit

• Reactivity:

  Human, Rat

• Immunogen:

  Amino acids QAKHKQRKRLKSSCKRHPLYVDFSDVGWND of human BMP2 were used as the immunogen for the BMP2 antibody.

• Clonality:

  Polyclonal

• Isotype:

  IgG

• Applications:

  WB, IHC-P, ELISA (protein)

• Purity:

  Antigen affinity

• Format:

  Antigen affinity purified

• Buffer:

  Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide

• Reconstitution:

  After reconstitution, the BMP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations:

  This BMP2 antibody is available for research use only.

• Storage Conditions:

  After reconstitution, the BMP2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation:

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes:

  Optimal dilution of the BMP2 antibody should be determined by the researcher.

• CAS Number:

  9007-83-4

• Location:

  Cytoplasmic

• Image Legend:

  Western blot testing of 1) rat brain, 2) rat lung, 3) human U87, 4) human HeLa lysate with BMP2 antibody. Expected molecular weight: 13-14 kDa per monomer.