BMP2 Antibody
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


BMP2 Antibody
Description :
BMP2 is also known as Bone morphogenetic protein 2 or BMP2A. It is mapped to 20p12. The protein encoded by this gene belongs to the transforming growth factor-beta (TGFB) superfamily.BMP-2, like otherbone morphogenetic proteins, plays an important role in the development of bone and cartilage. It is involved in thehedgehog pathway, TGF beta signaling pathway, and incytokine-cytokine receptor interaction. Also, it is involved in cardiac cell differentiation andepithelial to mesenchymal transition. In addition, BMP2A has been suggested as a reasonable candidate for the human condition fibrodysplasia (myositis) ossificans progressiva, on the basis of observations in a Drosophila model.Specifications :
Western blot: 0.1-0.5 µg/mL, IHC (FFPE) : 0.5-1 µg/mL, ELISA: 0.1-0.5 µg/mL (human protein tested) ; request BSA-free format for coatingUniProt :
P12643Host :
RabbitReactivity :
Human, RatImmunogen :
Amino acids QAKHKQRKRLKSSCKRHPLYVDFSDVGWND of human BMP2 were used as the immunogen for the BMP2 antibody.Clonality :
PolyclonalIsotype :
IgGApplications :
WB, IHC-P, ELISA (protein)Purity :
Antigen affinityFormat :
Antigen affinity purifiedBuffer :
Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azideReconstitution :
After reconstitution, the BMP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.Limitations :
This BMP2 antibody is available for research use only.Storage Conditions :
After reconstitution, the BMP2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.Formulation :
0.5 mg/mL if reconstituted with 0.2ml sterile DI waterApplications Notes :
Optimal dilution of the BMP2 antibody should be determined by the researcher.CAS Number :
9007-83-4Location :
CytoplasmicImage Legend :
Western blot testing of 1) rat brain, 2) rat lung, 3) human U87, 4) human HeLa lysate with BMP2 antibody. Expected molecular weight: 13-14 kDa per monomer.

