BMP2 Antibody

CAT:
800-R31949
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
BMP2 Antibody - image 1

BMP2 Antibody

  • Description :

    BMP2 is also known as Bone morphogenetic protein 2 or BMP2A. It is mapped to 20p12. The protein encoded by this gene belongs to the transforming growth factor-beta (TGFB) superfamily.BMP-2, like otherbone morphogenetic proteins, plays an important role in the development of bone and cartilage. It is involved in thehedgehog pathway, TGF beta signaling pathway, and incytokine-cytokine receptor interaction. Also, it is involved in cardiac cell differentiation andepithelial to mesenchymal transition. In addition, BMP2A has been suggested as a reasonable candidate for the human condition fibrodysplasia (myositis) ossificans progressiva, on the basis of observations in a Drosophila model.
  • Specifications :

    Western blot: 0.1-0.5 µg/mL, IHC (FFPE) : 0.5-1 µg/mL, ELISA: 0.1-0.5 µg/mL (human protein tested) ; request BSA-free format for coating
  • UniProt :

    P12643
  • Host :

    Rabbit
  • Reactivity :

    Human, Rat
  • Immunogen :

    Amino acids QAKHKQRKRLKSSCKRHPLYVDFSDVGWND of human BMP2 were used as the immunogen for the BMP2 antibody.
  • Clonality :

    Polyclonal
  • Isotype :

    IgG
  • Applications :

    WB, IHC-P, ELISA (protein)
  • Purity :

    Antigen affinity
  • Format :

    Antigen affinity purified
  • Buffer :

    Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
  • Reconstitution :

    After reconstitution, the BMP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Limitations :

    This BMP2 antibody is available for research use only.
  • Storage Conditions :

    After reconstitution, the BMP2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Formulation :

    0.5 mg/mL if reconstituted with 0.2ml sterile DI water
  • Applications Notes :

    Optimal dilution of the BMP2 antibody should be determined by the researcher.
  • CAS Number :

    9007-83-4
  • Location :

    Cytoplasmic
  • Image Legend :

    Western blot testing of 1) rat brain, 2) rat lung, 3) human U87, 4) human HeLa lysate with BMP2 antibody. Expected molecular weight: 13-14 kDa per monomer.

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide