SPP1 Antibody

CAT:
800-R31935
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
SPP1 Antibody - image 1

SPP1 Antibody

  • Description:

    Osteopontin (OPN), also known as secreted phosphoprotein 1 (SPP1), is a protein that in humans is encoded by the SPP1 gene (secreted phosphoprotein 1) . The protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix. And the encoded protein is secreted and binds hydroxyapatite with high affinity. The osteoclast vitronectin receptor is found in the cell membrane and may be involved in the binding to this protein. Also, this protein is a cytokine that upregulates expression of interferon-gamma and interleukin-12. Several transcript variants encoding different isoforms have been found for this gene.
  • Specifications:

    Western blot: 0.1-0.5 µg/mL, ELISA: 0.1-0.5 µg/mL (human protein tested) ; request BSA-free format for coating
  • UniProt:

    P10451
  • Host:

    Rabbit
  • Reactivity:

    Human, Mouse, Rat
  • Immunogen:

    Amino acids HEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN of human Osteopontin/SPP1 were used as the immunogen for the SPP1 antibody.
  • Clonality:

    Polyclonal
  • Isotype:

    IgG
  • Applications:

    WB, ELISA (protein)
  • Purity:

    Antigen affinity
  • Format:

    Antigen affinity purified
  • Buffer:

    Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
  • Reconstitution:

    After reconstitution, the SPP1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Limitations:

    This SPP1 antibody is available for research use only.
  • Storage Conditions:

    After reconstitution, the SPP1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Formulation:

    0.5 mg/mL if reconstituted with 0.2ml sterile DI water
  • Applications Notes:

    Optimal dilution of the SPP1 antibody should be determined by the researcher.
  • CAS Number:

    9007-83-4
  • Location:

    Cytoplasmic
  • Image Legend:

    Western blot testing of 1) mouse pancreas, 2) human Jurkat and 3) human HepG2 lysate with SPP1 antibody. Expected/observed molecular weight: 35/60-65 kDa (unmodified/glycosylated) .