UNC5C Antibody

• Description:

  Netrin receptor UNC5C is a protein that in humans is encoded by the UNC5C gene. This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediates the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig) -like domains and 2 type I thrombospondin motifs in the extracellular region.

• Specifications:

  Western blot: 0.1-0.5 µg/mL, Flow cytometry: 1-3ug/million cells

• UniProt:

  O95185

• Host:

  Rabbit

• Reactivity:

  Human, Mouse, Rat

• Immunogen:

  Amino acids DLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAEGQ of human UNC5C were used as the immunogen for the UNC5C antibody.

• Clonality:

  Polyclonal

• Isotype:

  IgG

• Applications:

  WB, FACS

• Purity:

  Antigen affinity

• Format:

  Antigen affinity purified

• Buffer:

  Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

• Reconstitution:

  After reconstitution, the UNC5C antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations:

  This UNC5C antibody is available for research use only.

• Storage Conditions:

  After reconstitution, the UNC5C antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation:

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes:

  Optimal dilution of the UNC5C antibody should be determined by the researcher.

• CAS Number:

  9007-83-4

• Image Legend:

  Western blot testing of 1) rat brain, 2) mouse brain and 3) human HeLa lysate with UNC5C antibody. Predicted molecular weight ~103 kDa, observed here at ~115 kDa.